Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 64415..65058 | Replicon | plasmid unnamed6 |
| Accession | NZ_CP101782 | ||
| Organism | Klebsiella pneumoniae strain hvKP340 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NPJ84_RS29540 | Protein ID | WP_001044770.1 |
| Coordinates | 64415..64831 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NPJ84_RS29545 | Protein ID | WP_001261282.1 |
| Coordinates | 64828..65058 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ84_RS29505 (60330) | 60330..60752 | - | 423 | WP_001340589.1 | organomercurial transporter MerC | - |
| NPJ84_RS29510 (60788) | 60788..61063 | - | 276 | WP_000732292.1 | mercury resistance system periplasmic binding protein MerP | - |
| NPJ84_RS29515 (61077) | 61077..61427 | - | 351 | WP_001294663.1 | mercuric transport protein MerT | - |
| NPJ84_RS29520 (61499) | 61499..61933 | + | 435 | WP_000429836.1 | Hg(II)-responsive transcriptional regulator | - |
| NPJ84_RS29525 (62012) | 62012..63016 | + | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| NPJ84_RS29530 (63296) | 63296..63568 | - | 273 | Protein_81 | transposase | - |
| NPJ84_RS29540 (64415) | 64415..64831 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPJ84_RS29545 (64828) | 64828..65058 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPJ84_RS29550 (65015) | 65015..65431 | + | 417 | WP_226329738.1 | hypothetical protein | - |
| NPJ84_RS29555 (65637) | 65637..66581 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| NPJ84_RS29560 (66618) | 66618..67010 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| NPJ84_RS29565 (67068) | 67068..67589 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| NPJ84_RS29570 (67635) | 67635..67838 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| NPJ84_RS29575 (67868) | 67868..68872 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| NPJ84_RS29580 (69056) | 69056..69835 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 | - | 1..111949 | 111949 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T252689 WP_001044770.1 NZ_CP101782:c64831-64415 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |