Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 64415..65058 Replicon plasmid unnamed6
Accession NZ_CP101782
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NPJ84_RS29540 Protein ID WP_001044770.1
Coordinates 64415..64831 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NPJ84_RS29545 Protein ID WP_001261282.1
Coordinates 64828..65058 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS29505 (60330) 60330..60752 - 423 WP_001340589.1 organomercurial transporter MerC -
NPJ84_RS29510 (60788) 60788..61063 - 276 WP_000732292.1 mercury resistance system periplasmic binding protein MerP -
NPJ84_RS29515 (61077) 61077..61427 - 351 WP_001294663.1 mercuric transport protein MerT -
NPJ84_RS29520 (61499) 61499..61933 + 435 WP_000429836.1 Hg(II)-responsive transcriptional regulator -
NPJ84_RS29525 (62012) 62012..63016 + 1005 WP_000427619.1 IS110-like element IS5075 family transposase -
NPJ84_RS29530 (63296) 63296..63568 - 273 Protein_81 transposase -
NPJ84_RS29540 (64415) 64415..64831 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NPJ84_RS29545 (64828) 64828..65058 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPJ84_RS29550 (65015) 65015..65431 + 417 WP_226329738.1 hypothetical protein -
NPJ84_RS29555 (65637) 65637..66581 + 945 WP_011977810.1 hypothetical protein -
NPJ84_RS29560 (66618) 66618..67010 + 393 WP_011977811.1 hypothetical protein -
NPJ84_RS29565 (67068) 67068..67589 + 522 WP_013214008.1 hypothetical protein -
NPJ84_RS29570 (67635) 67635..67838 + 204 WP_011977813.1 hypothetical protein -
NPJ84_RS29575 (67868) 67868..68872 + 1005 WP_011977814.1 hypothetical protein -
NPJ84_RS29580 (69056) 69056..69835 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-65 / blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 - 1..111949 111949


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252689 WP_001044770.1 NZ_CP101782:c64831-64415 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT252689 WP_001261282.1 NZ_CP101782:c65058-64828 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References