Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 5872..6397 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP101778 | ||
| Organism | Klebsiella pneumoniae strain hvKP340 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | NPJ84_RS28070 | Protein ID | WP_013023785.1 |
| Coordinates | 5872..6177 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | R4WC25 |
| Locus tag | NPJ84_RS28075 | Protein ID | WP_015632547.1 |
| Coordinates | 6179..6397 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ84_RS28040 (NPJ84_28040) | 1559..2185 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
| NPJ84_RS28045 (NPJ84_28045) | 2182..2484 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| NPJ84_RS28050 (NPJ84_28050) | 2948..3742 | - | 795 | WP_004197635.1 | site-specific integrase | - |
| NPJ84_RS28055 (NPJ84_28055) | 3940..4956 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
| NPJ84_RS28060 (NPJ84_28060) | 4967..5281 | - | 315 | WP_053389906.1 | hypothetical protein | - |
| NPJ84_RS28065 (NPJ84_28065) | 5308..5703 | - | 396 | WP_017899885.1 | hypothetical protein | - |
| NPJ84_RS28070 (NPJ84_28070) | 5872..6177 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NPJ84_RS28075 (NPJ84_28075) | 6179..6397 | - | 219 | WP_015632547.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NPJ84_RS28080 (NPJ84_28080) | 6606..6827 | - | 222 | Protein_9 | hypothetical protein | - |
| NPJ84_RS28085 (NPJ84_28085) | 7215..7505 | - | 291 | WP_013023783.1 | hypothetical protein | - |
| NPJ84_RS28090 (NPJ84_28090) | 7502..8629 | - | 1128 | WP_013023782.1 | DUF4238 domain-containing protein | - |
| NPJ84_RS28095 (NPJ84_28095) | 8663..10186 | - | 1524 | WP_017899887.1 | hypothetical protein | - |
| NPJ84_RS28100 (NPJ84_28100) | 10462..11241 | - | 780 | WP_013023780.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / mph(A) | - | 1..57405 | 57405 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T252684 WP_013023785.1 NZ_CP101778:c6177-5872 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1KT86 |