Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5872..6397 Replicon plasmid unnamed2
Accession NZ_CP101778
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NPJ84_RS28070 Protein ID WP_013023785.1
Coordinates 5872..6177 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID R4WC25
Locus tag NPJ84_RS28075 Protein ID WP_015632547.1
Coordinates 6179..6397 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS28040 (NPJ84_28040) 1559..2185 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NPJ84_RS28045 (NPJ84_28045) 2182..2484 + 303 WP_004197636.1 hypothetical protein -
NPJ84_RS28050 (NPJ84_28050) 2948..3742 - 795 WP_004197635.1 site-specific integrase -
NPJ84_RS28055 (NPJ84_28055) 3940..4956 - 1017 WP_017899884.1 hypothetical protein -
NPJ84_RS28060 (NPJ84_28060) 4967..5281 - 315 WP_053389906.1 hypothetical protein -
NPJ84_RS28065 (NPJ84_28065) 5308..5703 - 396 WP_017899885.1 hypothetical protein -
NPJ84_RS28070 (NPJ84_28070) 5872..6177 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NPJ84_RS28075 (NPJ84_28075) 6179..6397 - 219 WP_015632547.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NPJ84_RS28080 (NPJ84_28080) 6606..6827 - 222 Protein_9 hypothetical protein -
NPJ84_RS28085 (NPJ84_28085) 7215..7505 - 291 WP_013023783.1 hypothetical protein -
NPJ84_RS28090 (NPJ84_28090) 7502..8629 - 1128 WP_013023782.1 DUF4238 domain-containing protein -
NPJ84_RS28095 (NPJ84_28095) 8663..10186 - 1524 WP_017899887.1 hypothetical protein -
NPJ84_RS28100 (NPJ84_28100) 10462..11241 - 780 WP_013023780.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aac(6')-Ib-cr / ARR-3 / dfrA27 / aadA16 / qacE / sul1 / mph(A) - 1..57405 57405


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T252684 WP_013023785.1 NZ_CP101778:c6177-5872 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7247

>AT252684 WP_015632547.1 NZ_CP101778:c6397-6179 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRAERWQAENQEGMAEVARFIDMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2L1KT86

References