Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 5570853..5571523 Replicon chromosome
Accession NZ_CP101776
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NPJ84_RS27555 Protein ID WP_004213072.1
Coordinates 5570853..5571296 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NPJ84_RS27560 Protein ID WP_004213073.1
Coordinates 5571293..5571523 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS27520 (NPJ84_27520) 5566273..5566539 + 267 WP_147021650.1 carboxymuconolactone decarboxylase family protein -
NPJ84_RS27525 (NPJ84_27525) 5566602..5567093 + 492 WP_011251327.1 DM13 domain-containing protein -
NPJ84_RS27530 (NPJ84_27530) 5567142..5568062 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NPJ84_RS27535 (NPJ84_27535) 5568153..5568556 + 404 Protein_5385 GAF domain-containing protein -
NPJ84_RS27540 (NPJ84_27540) 5569074..5569709 - 636 Protein_5386 mucoid phenotype regulator RmpA2 -
NPJ84_RS27545 (NPJ84_27545) 5570126..5570430 + 305 Protein_5387 transposase -
NPJ84_RS27550 (NPJ84_27550) 5570453..5570704 - 252 WP_186987481.1 hypothetical protein -
NPJ84_RS27555 (NPJ84_27555) 5570853..5571296 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NPJ84_RS27560 (NPJ84_27560) 5571293..5571523 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPJ84_RS27565 (NPJ84_27565) 5572131..5573264 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NPJ84_RS27570 (NPJ84_27570) 5573280..5573573 + 294 WP_004213076.1 hypothetical protein -
NPJ84_RS27575 (NPJ84_27575) 5573563..5573769 - 207 WP_004213077.1 hypothetical protein -
NPJ84_RS27580 (NPJ84_27580) 5574121..5574411 + 291 WP_004213078.1 hypothetical protein -
NPJ84_RS27585 (NPJ84_27585) 5574401..5575300 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - iroN / iucA / iucB / iucC / iucD / iutA 5386384..5609234 222850


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T252683 WP_004213072.1 NZ_CP101776:c5571296-5570853 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT252683 WP_004213073.1 NZ_CP101776:c5571523-5571293 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References