Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 5570853..5571523 | Replicon | chromosome |
| Accession | NZ_CP101776 | ||
| Organism | Klebsiella pneumoniae strain hvKP340 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | NPJ84_RS27555 | Protein ID | WP_004213072.1 |
| Coordinates | 5570853..5571296 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | NPJ84_RS27560 | Protein ID | WP_004213073.1 |
| Coordinates | 5571293..5571523 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ84_RS27520 (NPJ84_27520) | 5566273..5566539 | + | 267 | WP_147021650.1 | carboxymuconolactone decarboxylase family protein | - |
| NPJ84_RS27525 (NPJ84_27525) | 5566602..5567093 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| NPJ84_RS27530 (NPJ84_27530) | 5567142..5568062 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| NPJ84_RS27535 (NPJ84_27535) | 5568153..5568556 | + | 404 | Protein_5385 | GAF domain-containing protein | - |
| NPJ84_RS27540 (NPJ84_27540) | 5569074..5569709 | - | 636 | Protein_5386 | mucoid phenotype regulator RmpA2 | - |
| NPJ84_RS27545 (NPJ84_27545) | 5570126..5570430 | + | 305 | Protein_5387 | transposase | - |
| NPJ84_RS27550 (NPJ84_27550) | 5570453..5570704 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| NPJ84_RS27555 (NPJ84_27555) | 5570853..5571296 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPJ84_RS27560 (NPJ84_27560) | 5571293..5571523 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPJ84_RS27565 (NPJ84_27565) | 5572131..5573264 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| NPJ84_RS27570 (NPJ84_27570) | 5573280..5573573 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| NPJ84_RS27575 (NPJ84_27575) | 5573563..5573769 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| NPJ84_RS27580 (NPJ84_27580) | 5574121..5574411 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| NPJ84_RS27585 (NPJ84_27585) | 5574401..5575300 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | iroN / iucA / iucB / iucC / iucD / iutA | 5386384..5609234 | 222850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T252683 WP_004213072.1 NZ_CP101776:c5571296-5570853 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|