Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 5537174..5538084 Replicon chromosome
Accession NZ_CP101776
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NPJ84_RS27355 Protein ID WP_004026354.1
Coordinates 5537174..5537644 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NPJ84_RS27360 Protein ID WP_004026357.1
Coordinates 5537641..5538084 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS27315 (NPJ84_27315) 5532490..5532804 + 315 WP_011251273.1 hypothetical protein -
NPJ84_RS27320 (NPJ84_27320) 5532813..5533307 + 495 WP_011251274.1 hypothetical protein -
NPJ84_RS27325 (NPJ84_27325) 5533313..5533753 + 441 WP_011251275.1 hypothetical protein -
NPJ84_RS27330 (NPJ84_27330) 5534178..5535134 - 957 WP_011251280.1 DsbA family protein -
NPJ84_RS27335 (NPJ84_27335) 5535194..5535535 - 342 WP_011251281.1 hypothetical protein -
NPJ84_RS27340 (NPJ84_27340) 5535549..5535860 - 312 WP_011251282.1 hypothetical protein -
NPJ84_RS27345 (NPJ84_27345) 5535877..5536326 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NPJ84_RS27355 (NPJ84_27355) 5537174..5537644 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NPJ84_RS27360 (NPJ84_27360) 5537641..5538084 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NPJ84_RS27365 (NPJ84_27365) 5538185..5538688 - 504 Protein_5351 DUF4113 domain-containing protein -
NPJ84_RS27370 (NPJ84_27370) 5538894..5539874 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
NPJ84_RS27375 (NPJ84_27375) 5539940..5541247 + 1308 Protein_5353 FepA family TonB-dependent siderophore receptor -
NPJ84_RS27380 (NPJ84_27380) 5541309..5541530 + 222 WP_004213615.1 hypothetical protein -
NPJ84_RS27385 (NPJ84_27385) 5541874..5542836 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - iroN / iucA / iucB / iucC / iucD / iutA 5386384..5609234 222850
- inside IScluster/Tn - iroN 5530893..5544440 13547


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T252682 WP_004026354.1 NZ_CP101776:c5537644-5537174 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT252682 WP_004026357.1 NZ_CP101776:c5538084-5537641 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References