Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4159246..4159865 Replicon chromosome
Accession NZ_CP101776
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPJ84_RS20675 Protein ID WP_002892050.1
Coordinates 4159647..4159865 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPJ84_RS20670 Protein ID WP_002892066.1
Coordinates 4159246..4159620 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS20660 (NPJ84_20660) 4154398..4155591 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NPJ84_RS20665 (NPJ84_20665) 4155614..4158760 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NPJ84_RS20670 (NPJ84_20670) 4159246..4159620 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPJ84_RS20675 (NPJ84_20675) 4159647..4159865 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NPJ84_RS20680 (NPJ84_20680) 4160024..4160590 + 567 WP_002892030.1 maltose O-acetyltransferase -
NPJ84_RS20685 (NPJ84_20685) 4160562..4160702 - 141 WP_004147370.1 hypothetical protein -
NPJ84_RS20690 (NPJ84_20690) 4160723..4161193 + 471 WP_002892026.1 YlaC family protein -
NPJ84_RS20695 (NPJ84_20695) 4161168..4162619 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NPJ84_RS20700 (NPJ84_20700) 4162720..4163418 + 699 WP_002892021.1 GNAT family protein -
NPJ84_RS20705 (NPJ84_20705) 4163415..4163555 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPJ84_RS20710 (NPJ84_20710) 4163555..4163818 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252676 WP_002892050.1 NZ_CP101776:4159647-4159865 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252676 WP_002892066.1 NZ_CP101776:4159246-4159620 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References