Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 3336371..3337002 Replicon chromosome
Accession NZ_CP101776
Organism Klebsiella pneumoniae strain hvKP340

Toxin (Protein)


Gene name hicA Uniprot ID A0A1Q8YTV3
Locus tag NPJ84_RS16725 Protein ID WP_012542177.1
Coordinates 3336826..3337002 (-) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A3Q9U6R4
Locus tag NPJ84_RS16720 Protein ID WP_017898984.1
Coordinates 3336371..3336778 (-) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ84_RS16685 (NPJ84_16685) 3331735..3332169 - 435 WP_012542168.1 phage terminase small subunit P27 family -
NPJ84_RS16690 (NPJ84_16690) 3332417..3332848 - 432 WP_023279521.1 hypothetical protein -
NPJ84_RS16695 (NPJ84_16695) 3332845..3333162 - 318 WP_023279522.1 hypothetical protein -
NPJ84_RS16700 (NPJ84_16700) 3333114..3333476 - 363 WP_014228901.1 HNH endonuclease -
NPJ84_RS16705 (NPJ84_16705) 3334601..3334951 - 351 WP_017898986.1 hypothetical protein -
NPJ84_RS16710 (NPJ84_16710) 3334948..3335445 - 498 WP_023279523.1 lysozyme -
NPJ84_RS16715 (NPJ84_16715) 3335445..3335660 - 216 WP_017880269.1 class II holin family protein -
NPJ84_RS16720 (NPJ84_16720) 3336371..3336778 - 408 WP_017898984.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NPJ84_RS16725 (NPJ84_16725) 3336826..3337002 - 177 WP_012542177.1 type II toxin-antitoxin system HicA family toxin Toxin
NPJ84_RS16730 (NPJ84_16730) 3337366..3339150 + 1785 WP_032415155.1 ATP-binding protein -
NPJ84_RS16735 (NPJ84_16735) 3339170..3340204 + 1035 WP_219071718.1 DNA cytosine methyltransferase -
NPJ84_RS16740 (NPJ84_16740) 3340229..3340570 - 342 WP_017898982.1 antiterminator Q family protein -
NPJ84_RS16745 (NPJ84_16745) 3340583..3341614 - 1032 WP_071058942.1 DUF968 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3302902..3357941 55039


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-61)


Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6632.83 Da        Isoelectric Point: 11.0174

>T252675 WP_012542177.1 NZ_CP101776:c3337002-3336826 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK

Download         Length: 177 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14959.96 Da        Isoelectric Point: 4.4277

>AT252675 WP_017898984.1 NZ_CP101776:c3336778-3336371 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q8YTV3

Antitoxin

Source ID Structure
AlphaFold DB A0A3Q9U6R4

References