Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 108474..109144 Replicon plasmid unnamed4
Accession NZ_CP101774
Organism Klebsiella pneumoniae strain hvKP323

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NO368_RS28165 Protein ID WP_004213072.1
Coordinates 108474..108917 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NO368_RS28170 Protein ID WP_004213073.1
Coordinates 108914..109144 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO368_RS28130 (NO368_28130) 103885..104160 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NO368_RS28135 (NO368_28135) 104223..104714 + 492 WP_011251327.1 DM13 domain-containing protein -
NO368_RS28140 (NO368_28140) 104763..105683 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NO368_RS28145 (NO368_28145) 105774..106177 + 404 Protein_124 GAF domain-containing protein -
NO368_RS28150 (NO368_28150) 106695..107330 - 636 Protein_125 mucoid phenotype regulator RmpA2 -
NO368_RS28155 (NO368_28155) 107747..108051 + 305 Protein_126 transposase -
NO368_RS28160 (NO368_28160) 108074..108325 - 252 WP_186987481.1 hypothetical protein -
NO368_RS28165 (NO368_28165) 108474..108917 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NO368_RS28170 (NO368_28170) 108914..109144 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NO368_RS28175 (NO368_28175) 109752..110885 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NO368_RS28180 (NO368_28180) 110901..111194 + 294 WP_004213076.1 hypothetical protein -
NO368_RS28185 (NO368_28185) 111184..111390 - 207 WP_004213077.1 hypothetical protein -
NO368_RS28190 (NO368_28190) 111742..112032 + 291 WP_004213078.1 hypothetical protein -
NO368_RS28195 (NO368_28195) 112022..112921 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..190026 190026


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T252660 WP_004213072.1 NZ_CP101774:c108917-108474 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT252660 WP_004213073.1 NZ_CP101774:c109144-108914 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References