Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 74795..75705 Replicon plasmid unnamed4
Accession NZ_CP101774
Organism Klebsiella pneumoniae strain hvKP323

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NO368_RS27965 Protein ID WP_004026354.1
Coordinates 74795..75265 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NO368_RS27970 Protein ID WP_004026357.1
Coordinates 75262..75705 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO368_RS27925 (NO368_27925) 70111..70425 + 315 WP_011251273.1 hypothetical protein -
NO368_RS27930 (NO368_27930) 70434..70928 + 495 WP_011251274.1 hypothetical protein -
NO368_RS27935 (NO368_27935) 70934..71374 + 441 WP_011251275.1 hypothetical protein -
NO368_RS27940 (NO368_27940) 71799..72755 - 957 WP_011251280.1 DsbA family protein -
NO368_RS27945 (NO368_27945) 72815..73156 - 342 WP_011251281.1 hypothetical protein -
NO368_RS27950 (NO368_27950) 73170..73481 - 312 WP_011251282.1 hypothetical protein -
NO368_RS27955 (NO368_27955) 73498..73947 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NO368_RS27965 (NO368_27965) 74795..75265 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NO368_RS27970 (NO368_27970) 75262..75705 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NO368_RS27975 (NO368_27975) 75806..76309 - 504 Protein_90 DUF4113 domain-containing protein -
NO368_RS27980 (NO368_27980) 76515..77495 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
NO368_RS27985 (NO368_27985) 77561..78868 + 1308 Protein_92 FepA family TonB-dependent siderophore receptor -
NO368_RS27990 (NO368_27990) 78930..79151 + 222 WP_004213615.1 hypothetical protein -
NO368_RS27995 (NO368_27995) 79495..80457 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..190026 190026
- inside IScluster/Tn - iroN 68514..82106 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T252659 WP_004026354.1 NZ_CP101774:c75265-74795 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT252659 WP_004026357.1 NZ_CP101774:c75705-75262 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References