Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 12306..12949 | Replicon | plasmid unnamed4 |
| Accession | NZ_CP101774 | ||
| Organism | Klebsiella pneumoniae strain hvKP323 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NO368_RS27615 | Protein ID | WP_001044770.1 |
| Coordinates | 12533..12949 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NO368_RS27610 | Protein ID | WP_001261282.1 |
| Coordinates | 12306..12536 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO368_RS27585 (NO368_27585) | 8246..8413 | - | 168 | Protein_12 | IS1 family transposase | - |
| NO368_RS27590 (NO368_27590) | 8717..9646 | + | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| NO368_RS27595 (NO368_27595) | 9791..10570 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| NO368_RS27600 (NO368_27600) | 10567..11388 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| NO368_RS27605 (NO368_27605) | 11933..12349 | - | 417 | WP_226329738.1 | hypothetical protein | - |
| NO368_RS27610 (NO368_27610) | 12306..12536 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NO368_RS27615 (NO368_27615) | 12533..12949 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NO368_RS27620 (NO368_27620) | 13070..13767 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| NO368_RS27625 (NO368_27625) | 13796..14068 | + | 273 | Protein_20 | transposase | - |
| NO368_RS27630 (NO368_27630) | 14348..15352 | - | 1005 | WP_000427619.1 | IS110-like element IS5075 family transposase | - |
| NO368_RS27635 (NO368_27635) | 15443..15877 | - | 435 | WP_000405672.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..190026 | 190026 | |
| - | inside | IScluster/Tn | - | - | 13390..38413 | 25023 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T252657 WP_001044770.1 NZ_CP101774:12533-12949 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |