Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 12306..12949 Replicon plasmid unnamed4
Accession NZ_CP101774
Organism Klebsiella pneumoniae strain hvKP323

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NO368_RS27615 Protein ID WP_001044770.1
Coordinates 12533..12949 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NO368_RS27610 Protein ID WP_001261282.1
Coordinates 12306..12536 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO368_RS27585 (NO368_27585) 8246..8413 - 168 Protein_12 IS1 family transposase -
NO368_RS27590 (NO368_27590) 8717..9646 + 930 WP_004213558.1 Rpn family recombination-promoting nuclease/putative transposase -
NO368_RS27595 (NO368_27595) 9791..10570 - 780 WP_004213560.1 site-specific integrase -
NO368_RS27600 (NO368_27600) 10567..11388 - 822 WP_004213562.1 hypothetical protein -
NO368_RS27605 (NO368_27605) 11933..12349 - 417 WP_226329738.1 hypothetical protein -
NO368_RS27610 (NO368_27610) 12306..12536 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NO368_RS27615 (NO368_27615) 12533..12949 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NO368_RS27620 (NO368_27620) 13070..13767 + 698 WP_223174630.1 IS1 family transposase -
NO368_RS27625 (NO368_27625) 13796..14068 + 273 Protein_20 transposase -
NO368_RS27630 (NO368_27630) 14348..15352 - 1005 WP_000427619.1 IS110-like element IS5075 family transposase -
NO368_RS27635 (NO368_27635) 15443..15877 - 435 WP_000405672.1 Cd(II)/Pb(II)-responsive transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..190026 190026
- inside IScluster/Tn - - 13390..38413 25023


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252657 WP_001044770.1 NZ_CP101774:12533-12949 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT252657 WP_001261282.1 NZ_CP101774:12306-12536 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References