Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4136975..4137594 Replicon chromosome
Accession NZ_CP101770
Organism Klebsiella pneumoniae strain hvKP323

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NO368_RS20575 Protein ID WP_002892050.1
Coordinates 4137376..4137594 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NO368_RS20570 Protein ID WP_002892066.1
Coordinates 4136975..4137349 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO368_RS20560 (NO368_20560) 4132127..4133320 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NO368_RS20565 (NO368_20565) 4133343..4136489 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NO368_RS20570 (NO368_20570) 4136975..4137349 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NO368_RS20575 (NO368_20575) 4137376..4137594 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NO368_RS20580 (NO368_20580) 4137753..4138319 + 567 WP_002892030.1 maltose O-acetyltransferase -
NO368_RS20585 (NO368_20585) 4138291..4138431 - 141 WP_004147370.1 hypothetical protein -
NO368_RS20590 (NO368_20590) 4138452..4138922 + 471 WP_002892026.1 YlaC family protein -
NO368_RS20595 (NO368_20595) 4138897..4140348 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NO368_RS20600 (NO368_20600) 4140449..4141147 + 699 WP_002892021.1 GNAT family protein -
NO368_RS20605 (NO368_20605) 4141144..4141284 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NO368_RS20610 (NO368_20610) 4141284..4141547 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T252651 WP_002892050.1 NZ_CP101770:4137376-4137594 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT252651 WP_002892066.1 NZ_CP101770:4136975-4137349 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References