Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 3316071..3316702 | Replicon | chromosome |
| Accession | NZ_CP101770 | ||
| Organism | Klebsiella pneumoniae strain hvKP323 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | NO368_RS16635 | Protein ID | WP_012542177.1 |
| Coordinates | 3316526..3316702 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
| Locus tag | NO368_RS16630 | Protein ID | WP_017898984.1 |
| Coordinates | 3316071..3316478 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO368_RS16595 (NO368_16595) | 3311435..3311869 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
| NO368_RS16600 (NO368_16600) | 3312117..3312548 | - | 432 | WP_023279521.1 | hypothetical protein | - |
| NO368_RS16605 (NO368_16605) | 3312545..3312862 | - | 318 | WP_023279522.1 | hypothetical protein | - |
| NO368_RS16610 (NO368_16610) | 3312814..3313176 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
| NO368_RS16615 (NO368_16615) | 3314301..3314651 | - | 351 | WP_017898986.1 | hypothetical protein | - |
| NO368_RS16620 (NO368_16620) | 3314648..3315145 | - | 498 | WP_023279523.1 | lysozyme | - |
| NO368_RS16625 (NO368_16625) | 3315145..3315360 | - | 216 | WP_017880269.1 | class II holin family protein | - |
| NO368_RS16630 (NO368_16630) | 3316071..3316478 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NO368_RS16635 (NO368_16635) | 3316526..3316702 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NO368_RS16640 (NO368_16640) | 3317066..3318850 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
| NO368_RS16645 (NO368_16645) | 3318870..3319904 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
| NO368_RS16650 (NO368_16650) | 3319929..3320270 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
| NO368_RS16655 (NO368_16655) | 3320283..3321314 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3282602..3337641 | 55039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T252650 WP_012542177.1 NZ_CP101770:c3316702-3316526 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT252650 WP_017898984.1 NZ_CP101770:c3316478-3316071 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9U6R4 |