252633

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 271775..272445 Replicon plasmid unnamed1
Accession NZ_CP101765
Organism Klebsiella pneumoniae strain hvKP319

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NPJ83_RS28235 Protein ID WP_004213072.1
Coordinates 271775..272218 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NPJ83_RS28240 Protein ID WP_004213073.1
Coordinates 272215..272445 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ83_RS28200 (267186) 267186..267461 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NPJ83_RS28205 (267524) 267524..268015 + 492 WP_011251327.1 DM13 domain-containing protein -
NPJ83_RS28210 (268064) 268064..268984 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NPJ83_RS28215 (269075) 269075..269478 + 404 Protein_327 GAF domain-containing protein -
NPJ83_RS28220 (269996) 269996..270631 - 636 Protein_328 mucoid phenotype regulator RmpA2 -
NPJ83_RS28225 (271048) 271048..271352 + 305 Protein_329 transposase -
NPJ83_RS28230 (271375) 271375..271626 - 252 WP_186987481.1 hypothetical protein -
NPJ83_RS28235 (271775) 271775..272218 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NPJ83_RS28240 (272215) 272215..272445 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPJ83_RS28245 (273053) 273053..274186 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NPJ83_RS28250 (274202) 274202..274495 + 294 WP_004213076.1 hypothetical protein -
NPJ83_RS28255 (274485) 274485..274691 - 207 WP_004213077.1 hypothetical protein -
NPJ83_RS28260 (275043) 275043..275333 + 291 WP_004213078.1 hypothetical protein -
NPJ83_RS28265 (275323) 275323..276222 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..353327 353327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T252633 WP_004213072.1 NZ_CP101765:c272218-271775 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT252633 WP_004213073.1 NZ_CP101765:c272445-272215 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References