Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 271775..272445 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP101765 | ||
| Organism | Klebsiella pneumoniae strain hvKP319 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | NPJ83_RS28235 | Protein ID | WP_004213072.1 |
| Coordinates | 271775..272218 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | NPJ83_RS28240 | Protein ID | WP_004213073.1 |
| Coordinates | 272215..272445 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ83_RS28200 (267186) | 267186..267461 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| NPJ83_RS28205 (267524) | 267524..268015 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| NPJ83_RS28210 (268064) | 268064..268984 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| NPJ83_RS28215 (269075) | 269075..269478 | + | 404 | Protein_327 | GAF domain-containing protein | - |
| NPJ83_RS28220 (269996) | 269996..270631 | - | 636 | Protein_328 | mucoid phenotype regulator RmpA2 | - |
| NPJ83_RS28225 (271048) | 271048..271352 | + | 305 | Protein_329 | transposase | - |
| NPJ83_RS28230 (271375) | 271375..271626 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| NPJ83_RS28235 (271775) | 271775..272218 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPJ83_RS28240 (272215) | 272215..272445 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPJ83_RS28245 (273053) | 273053..274186 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| NPJ83_RS28250 (274202) | 274202..274495 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| NPJ83_RS28255 (274485) | 274485..274691 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| NPJ83_RS28260 (275043) | 275043..275333 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| NPJ83_RS28265 (275323) | 275323..276222 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..353327 | 353327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T252633 WP_004213072.1 NZ_CP101765:c272218-271775 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|