Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 238096..239006 Replicon plasmid unnamed1
Accession NZ_CP101765
Organism Klebsiella pneumoniae strain hvKP319

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NPJ83_RS28035 Protein ID WP_004026354.1
Coordinates 238096..238566 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NPJ83_RS28040 Protein ID WP_004026357.1
Coordinates 238563..239006 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPJ83_RS27995 (233412) 233412..233726 + 315 WP_011251273.1 hypothetical protein -
NPJ83_RS28000 (233735) 233735..234229 + 495 WP_011251274.1 hypothetical protein -
NPJ83_RS28005 (234235) 234235..234675 + 441 WP_011251275.1 hypothetical protein -
NPJ83_RS28010 (235100) 235100..236056 - 957 WP_011251280.1 DsbA family protein -
NPJ83_RS28015 (236116) 236116..236457 - 342 WP_011251281.1 hypothetical protein -
NPJ83_RS28020 (236471) 236471..236782 - 312 WP_011251282.1 hypothetical protein -
NPJ83_RS28025 (236799) 236799..237248 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NPJ83_RS28035 (238096) 238096..238566 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NPJ83_RS28040 (238563) 238563..239006 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NPJ83_RS28045 (239107) 239107..239610 - 504 Protein_293 DUF4113 domain-containing protein -
NPJ83_RS28050 (239816) 239816..240796 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
NPJ83_RS28055 (240862) 240862..242169 + 1308 Protein_295 FepA family TonB-dependent siderophore receptor -
NPJ83_RS28060 (242231) 242231..242452 + 222 WP_004213615.1 hypothetical protein -
NPJ83_RS28065 (242796) 242796..243758 - 963 WP_004902373.1 DEAD/DEAH box helicase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 1..353327 353327
- inside IScluster/Tn - iroN 231815..245407 13592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T252632 WP_004026354.1 NZ_CP101765:c238566-238096 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT252632 WP_004026357.1 NZ_CP101765:c239006-238563 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References