Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 238096..239006 | Replicon | plasmid unnamed1 |
Accession | NZ_CP101765 | ||
Organism | Klebsiella pneumoniae strain hvKP319 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A663AYG0 |
Locus tag | NPJ83_RS28035 | Protein ID | WP_004026354.1 |
Coordinates | 238096..238566 (-) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A6P1V3Q9 |
Locus tag | NPJ83_RS28040 | Protein ID | WP_004026357.1 |
Coordinates | 238563..239006 (-) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ83_RS27995 (233412) | 233412..233726 | + | 315 | WP_011251273.1 | hypothetical protein | - |
NPJ83_RS28000 (233735) | 233735..234229 | + | 495 | WP_011251274.1 | hypothetical protein | - |
NPJ83_RS28005 (234235) | 234235..234675 | + | 441 | WP_011251275.1 | hypothetical protein | - |
NPJ83_RS28010 (235100) | 235100..236056 | - | 957 | WP_011251280.1 | DsbA family protein | - |
NPJ83_RS28015 (236116) | 236116..236457 | - | 342 | WP_011251281.1 | hypothetical protein | - |
NPJ83_RS28020 (236471) | 236471..236782 | - | 312 | WP_011251282.1 | hypothetical protein | - |
NPJ83_RS28025 (236799) | 236799..237248 | - | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
NPJ83_RS28035 (238096) | 238096..238566 | - | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
NPJ83_RS28040 (238563) | 238563..239006 | - | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
NPJ83_RS28045 (239107) | 239107..239610 | - | 504 | Protein_293 | DUF4113 domain-containing protein | - |
NPJ83_RS28050 (239816) | 239816..240796 | - | 981 | WP_000019473.1 | IS5-like element ISKpn26 family transposase | - |
NPJ83_RS28055 (240862) | 240862..242169 | + | 1308 | Protein_295 | FepA family TonB-dependent siderophore receptor | - |
NPJ83_RS28060 (242231) | 242231..242452 | + | 222 | WP_004213615.1 | hypothetical protein | - |
NPJ83_RS28065 (242796) | 242796..243758 | - | 963 | WP_004902373.1 | DEAD/DEAH box helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaSHV-12 / rmtB / blaTEM-1B / blaCTX-M-65 | iroN / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..353327 | 353327 | |
- | inside | IScluster/Tn | - | iroN | 231815..245407 | 13592 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T252632 WP_004026354.1 NZ_CP101765:c238566-238096 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT252632 WP_004026357.1 NZ_CP101765:c239006-238563 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A663AYG0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6P1V3Q9 |