Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5325485..5326110 | Replicon | chromosome |
Accession | NZ_CP101764 | ||
Organism | Klebsiella pneumoniae strain hvKP319 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NPJ83_RS26195 | Protein ID | WP_002882817.1 |
Coordinates | 5325485..5325868 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NPJ83_RS26200 | Protein ID | WP_004150355.1 |
Coordinates | 5325868..5326110 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPJ83_RS26180 (NPJ83_26180) | 5322851..5323753 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NPJ83_RS26185 (NPJ83_26185) | 5323750..5324385 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NPJ83_RS26190 (NPJ83_26190) | 5324382..5325311 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NPJ83_RS26195 (NPJ83_26195) | 5325485..5325868 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NPJ83_RS26200 (NPJ83_26200) | 5325868..5326110 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NPJ83_RS26205 (NPJ83_26205) | 5326315..5327232 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
NPJ83_RS26210 (NPJ83_26210) | 5327246..5328187 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NPJ83_RS26215 (NPJ83_26215) | 5328232..5328669 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NPJ83_RS26220 (NPJ83_26220) | 5328666..5329526 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
NPJ83_RS26225 (NPJ83_26225) | 5329520..5330119 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T252623 WP_002882817.1 NZ_CP101764:c5325868-5325485 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |