Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 3301475..3302106 | Replicon | chromosome |
| Accession | NZ_CP101764 | ||
| Organism | Klebsiella pneumoniae strain hvKP319 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A1Q8YTV3 |
| Locus tag | NPJ83_RS16465 | Protein ID | WP_012542177.1 |
| Coordinates | 3301930..3302106 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3Q9U6R4 |
| Locus tag | NPJ83_RS16460 | Protein ID | WP_017898984.1 |
| Coordinates | 3301475..3301882 (-) | Length | 136 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPJ83_RS16425 (NPJ83_16425) | 3296839..3297273 | - | 435 | WP_012542168.1 | phage terminase small subunit P27 family | - |
| NPJ83_RS16430 (NPJ83_16430) | 3297521..3297952 | - | 432 | WP_023279521.1 | hypothetical protein | - |
| NPJ83_RS16435 (NPJ83_16435) | 3297949..3298266 | - | 318 | WP_023279522.1 | hypothetical protein | - |
| NPJ83_RS16440 (NPJ83_16440) | 3298218..3298580 | - | 363 | WP_014228901.1 | HNH endonuclease | - |
| NPJ83_RS16445 (NPJ83_16445) | 3299705..3300055 | - | 351 | WP_017898986.1 | hypothetical protein | - |
| NPJ83_RS16450 (NPJ83_16450) | 3300052..3300549 | - | 498 | WP_023279523.1 | lysozyme | - |
| NPJ83_RS16455 (NPJ83_16455) | 3300549..3300764 | - | 216 | WP_017880269.1 | class II holin family protein | - |
| NPJ83_RS16460 (NPJ83_16460) | 3301475..3301882 | - | 408 | WP_017898984.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NPJ83_RS16465 (NPJ83_16465) | 3301930..3302106 | - | 177 | WP_012542177.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NPJ83_RS16470 (NPJ83_16470) | 3302470..3304254 | + | 1785 | WP_032415155.1 | ATP-binding protein | - |
| NPJ83_RS16475 (NPJ83_16475) | 3304274..3305308 | + | 1035 | WP_219071718.1 | DNA cytosine methyltransferase | - |
| NPJ83_RS16480 (NPJ83_16480) | 3305333..3305674 | - | 342 | WP_017898982.1 | antiterminator Q family protein | - |
| NPJ83_RS16485 (NPJ83_16485) | 3305687..3306718 | - | 1032 | WP_071058942.1 | DUF968 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3268006..3325517 | 57511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6632.83 Da Isoelectric Point: 11.0174
>T252618 WP_012542177.1 NZ_CP101764:c3302106-3301930 [Klebsiella pneumoniae]
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
VKQSELRRWLAAQGAEFKDGTNHLKIYLNGKQTVMPRHPGKEIPEPLRKAILKQLGIK
Download Length: 177 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14959.96 Da Isoelectric Point: 4.4277
>AT252618 WP_017898984.1 NZ_CP101764:c3301882-3301475 [Klebsiella pneumoniae]
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
MRYPVIFEHDETGWAVFFPDIPEAMTGGETREEALEMAQDALVTAFDFYFDDRREIPAPSAEGDAFVEVPASVAAKVLLL
NRLVSTNTSNADLARLINTRPQEVQRIVSLGHSTKIDTIQKALSALGQKMEIVVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YTV3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Q9U6R4 |