Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 6347788..6348362 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A4Z0IFX5 |
Locus tag | NOX82_RS27895 | Protein ID | WP_058073004.1 |
Coordinates | 6347788..6348153 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | W5ISP5 |
Locus tag | NOX82_RS27900 | Protein ID | WP_009613188.1 |
Coordinates | 6348147..6348362 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS27875 (NOX82_27875) | 6343332..6345743 | + | 2412 | WP_074982899.1 | TonB-dependent receptor | - |
NOX82_RS27880 (NOX82_27880) | 6345751..6346899 | + | 1149 | WP_116424334.1 | PepSY domain-containing protein | - |
NOX82_RS27885 (NOX82_27885) | 6346896..6347078 | + | 183 | WP_116424333.1 | hypothetical protein | - |
NOX82_RS27890 (NOX82_27890) | 6347075..6347800 | + | 726 | WP_256512967.1 | hypothetical protein | - |
NOX82_RS27895 (NOX82_27895) | 6347788..6348153 | - | 366 | WP_058073004.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NOX82_RS27900 (NOX82_27900) | 6348147..6348362 | - | 216 | WP_009613188.1 | CopG family transcriptional regulator | Antitoxin |
NOX82_RS27905 (NOX82_27905) | 6348431..6350455 | - | 2025 | WP_256512970.1 | oligopeptide transporter, OPT family | - |
NOX82_RS27910 (NOX82_27910) | 6350706..6351542 | - | 837 | WP_256512972.1 | taurine dioxygenase | - |
NOX82_RS27915 (NOX82_27915) | 6351771..6352589 | - | 819 | WP_256512974.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13380.44 Da Isoelectric Point: 5.8613
>T252608 WP_058073004.1 NZ_CP101752:c6348153-6347788 [Pseudomonas citronellolis]
MVKALFDTNILIDYLNGHEQARDELRRYDDPAISIVTWMEVMIGATPATAAATRAFLDSFALVPLDASVAERAVAVRQAL
RVKLPDAIIKASAEVQGRLLVTRNTRDFPVDDAGVRLPYRL
MVKALFDTNILIDYLNGHEQARDELRRYDDPAISIVTWMEVMIGATPATAAATRAFLDSFALVPLDASVAERAVAVRQAL
RVKLPDAIIKASAEVQGRLLVTRNTRDFPVDDAGVRLPYRL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Z0IFX5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1A5D6Z2 |