Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 6324451..6325118 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | VapC1 | Uniprot ID | W5ISM6 |
Locus tag | NOX82_RS27795 | Protein ID | WP_009613158.1 |
Coordinates | 6324708..6325118 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | VapB1 | Uniprot ID | - |
Locus tag | NOX82_RS27790 | Protein ID | WP_253412216.1 |
Coordinates | 6324451..6324711 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS27765 (NOX82_27765) | 6319731..6319973 | - | 243 | WP_074981193.1 | YdcH family protein | - |
NOX82_RS27770 (NOX82_27770) | 6320166..6320579 | + | 414 | WP_249918704.1 | large-conductance mechanosensitive channel protein MscL | - |
NOX82_RS27775 (NOX82_27775) | 6320597..6322150 | - | 1554 | WP_256512943.1 | TerC family protein | - |
NOX82_RS27780 (NOX82_27780) | 6322339..6323115 | - | 777 | WP_253392706.1 | ferredoxin--NADP reductase | - |
NOX82_RS27785 (NOX82_27785) | 6323244..6324368 | + | 1125 | WP_256515414.1 | class I SAM-dependent methyltransferase | - |
NOX82_RS27790 (NOX82_27790) | 6324451..6324711 | + | 261 | WP_253412216.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NOX82_RS27795 (NOX82_27795) | 6324708..6325118 | + | 411 | WP_009613158.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NOX82_RS27800 (NOX82_27800) | 6325823..6326398 | - | 576 | WP_256512950.1 | nucleotidyltransferase family protein | - |
NOX82_RS27805 (NOX82_27805) | 6326395..6327363 | - | 969 | WP_074982920.1 | XdhC family protein | - |
NOX82_RS27810 (NOX82_27810) | 6327365..6328600 | - | 1236 | WP_256512953.1 | cytochrome c | - |
NOX82_RS27815 (NOX82_27815) | 6328603..6329136 | - | 534 | WP_009613171.1 | (2Fe-2S)-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15448.80 Da Isoelectric Point: 7.1891
>T252607 WP_009613158.1 NZ_CP101752:6324708-6325118 [Pseudomonas citronellolis]
VKYLLDTNILIYLLKNRPESVARRVNALPADAGLCMSFFTYAELLKGAERSTRRSEVLRQLERLTRQVPVVYDGTPRLCE
HYATQFTRLKLAGTPIGANDLWIACHALALEATLVTHNTREFERIDGLCLEDWAAE
VKYLLDTNILIYLLKNRPESVARRVNALPADAGLCMSFFTYAELLKGAERSTRRSEVLRQLERLTRQVPVVYDGTPRLCE
HYATQFTRLKLAGTPIGANDLWIACHALALEATLVTHNTREFERIDGLCLEDWAAE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|