Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 4434542..4435095 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NOX82_RS19465 | Protein ID | WP_256511719.1 |
Coordinates | 4434542..4434817 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NOX82_RS19470 | Protein ID | WP_256511720.1 |
Coordinates | 4434817..4435095 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS19435 (NOX82_19435) | 4429596..4430510 | - | 915 | WP_256511715.1 | alpha/beta hydrolase | - |
NOX82_RS19440 (NOX82_19440) | 4430520..4431335 | - | 816 | WP_256511716.1 | SDR family NAD(P)-dependent oxidoreductase | - |
NOX82_RS19445 (NOX82_19445) | 4431535..4432584 | + | 1050 | WP_256511717.1 | Rieske 2Fe-2S domain-containing protein | - |
NOX82_RS19450 (NOX82_19450) | 4432687..4433817 | + | 1131 | WP_116425004.1 | helix-turn-helix transcriptional regulator | - |
NOX82_RS19455 (NOX82_19455) | 4433881..4434066 | + | 186 | WP_143096607.1 | hypothetical protein | - |
NOX82_RS19460 (NOX82_19460) | 4434068..4434493 | - | 426 | WP_043315128.1 | VOC family protein | - |
NOX82_RS19465 (NOX82_19465) | 4434542..4434817 | - | 276 | WP_256511719.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOX82_RS19470 (NOX82_19470) | 4434817..4435095 | - | 279 | WP_256511720.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NOX82_RS19475 (NOX82_19475) | 4435394..4435552 | + | 159 | WP_089390468.1 | hypothetical protein | - |
NOX82_RS19480 (NOX82_19480) | 4435561..4436184 | + | 624 | WP_116425073.1 | XRE family transcriptional regulator | - |
NOX82_RS19485 (NOX82_19485) | 4436253..4436756 | - | 504 | WP_256511721.1 | hypothetical protein | - |
NOX82_RS19490 (NOX82_19490) | 4437043..4437405 | + | 363 | Protein_3845 | ATP-binding protein | - |
NOX82_RS19495 (NOX82_19495) | 4437496..4437939 | + | 444 | WP_256515378.1 | NUDIX domain-containing protein | - |
NOX82_RS19500 (NOX82_19500) | 4438185..4439321 | + | 1137 | WP_249917019.1 | FMNH2-dependent alkanesulfonate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10556.17 Da Isoelectric Point: 10.5619
>T252602 WP_256511719.1 NZ_CP101752:c4434817-4434542 [Pseudomonas citronellolis]
MALQWTSKALSDLARLHEFLAPVNRSAAARTVQQLVAAPAVLLTNPRLGERLDEFAPRDVRRLLVGHYEMRYEIRGSDIH
LLRVWHTREER
MALQWTSKALSDLARLHEFLAPVNRSAAARTVQQLVAAPAVLLTNPRLGERLDEFAPRDVRRLLVGHYEMRYEIRGSDIH
LLRVWHTREER
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|