Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE(toxin) |
Location | 3069734..3070322 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NOX82_RS13815 | Protein ID | WP_083426757.1 |
Coordinates | 3069734..3070084 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A4Z0IXF0 |
Locus tag | NOX82_RS13820 | Protein ID | WP_074979635.1 |
Coordinates | 3070065..3070322 (-) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS13790 (NOX82_13790) | 3066115..3066861 | + | 747 | WP_253390768.1 | glucose 1-dehydrogenase | - |
NOX82_RS13795 (NOX82_13795) | 3066896..3067855 | + | 960 | WP_253390769.1 | VOC family protein | - |
NOX82_RS13800 (NOX82_13800) | 3067852..3068688 | + | 837 | WP_253411361.1 | alpha/beta fold hydrolase | - |
NOX82_RS13805 (NOX82_13805) | 3068693..3069118 | + | 426 | WP_009619921.1 | lipocalin-like domain-containing protein | - |
NOX82_RS13815 (NOX82_13815) | 3069734..3070084 | - | 351 | WP_083426757.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOX82_RS13820 (NOX82_13820) | 3070065..3070322 | - | 258 | WP_074979635.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NOX82_RS13825 (NOX82_13825) | 3070830..3071180 | - | 351 | WP_009619928.1 | hypothetical protein | - |
NOX82_RS13830 (NOX82_13830) | 3071612..3072037 | + | 426 | WP_074979636.1 | hydrogenase | - |
NOX82_RS13835 (NOX82_13835) | 3072343..3072762 | - | 420 | WP_256515078.1 | LytTR family DNA-binding domain-containing protein | - |
NOX82_RS13845 (NOX82_13845) | 3073455..3073670 | + | 216 | WP_009619935.1 | hypothetical protein | - |
NOX82_RS13850 (NOX82_13850) | 3073797..3074015 | - | 219 | WP_009619937.1 | hypothetical protein | - |
NOX82_RS13855 (NOX82_13855) | 3074159..3074536 | + | 378 | WP_256515079.1 | S24 family peptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13484.56 Da Isoelectric Point: 10.5002
>T252600 WP_083426757.1 NZ_CP101752:c3070084-3069734 [Pseudomonas citronellolis]
MTSKTGNNKQIKAPQQDLEDIKQYTLKFKETALKEWDRLKGPVKTQLIKKLGERLVNPRVEKDKLHGSENKDRYKIKLSA
SGYRLVYQVHDTEIVVEVVAVGKRERSAVYNESKKR
MTSKTGNNKQIKAPQQDLEDIKQYTLKFKETALKEWDRLKGPVKTQLIKKLGERLVNPRVEKDKLHGSENKDRYKIKLSA
SGYRLVYQVHDTEIVVEVVAVGKRERSAVYNESKKR
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|