Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1636883..1637526 Replicon chromosome
Accession NZ_CP101752
Organism Pseudomonas citronellolis strain C12

Toxin (Protein)


Gene name vapC Uniprot ID A0A4Z0IRR5
Locus tag NOX82_RS07535 Protein ID WP_074976585.1
Coordinates 1636883..1637296 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID W5IS21
Locus tag NOX82_RS07540 Protein ID WP_009620639.1
Coordinates 1637296..1637526 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOX82_RS07510 (NOX82_07510) 1631939..1632397 + 459 WP_256514597.1 sn-glycerol-3-phosphate transporter -
NOX82_RS07515 (NOX82_07515) 1632411..1633733 - 1323 WP_256514598.1 aminotransferase class III-fold pyridoxal phosphate-dependent enzyme -
NOX82_RS07520 (NOX82_07520) 1633730..1634794 - 1065 WP_253392604.1 phosphotransferase -
NOX82_RS07525 (NOX82_07525) 1634938..1635672 + 735 WP_009620642.1 SDR family oxidoreductase -
NOX82_RS07530 (NOX82_07530) 1635737..1636426 + 690 WP_249917615.1 GntR family transcriptional regulator -
NOX82_RS07535 (NOX82_07535) 1636883..1637296 - 414 WP_074976585.1 tRNA(fMet)-specific endonuclease VapC Toxin
NOX82_RS07540 (NOX82_07540) 1637296..1637526 - 231 WP_009620639.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NOX82_RS07545 (NOX82_07545) 1637659..1638360 - 702 WP_009620638.1 ATP-binding cassette domain-containing protein -
NOX82_RS07550 (NOX82_07550) 1638364..1639131 - 768 WP_074976582.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NOX82_RS07555 (NOX82_07555) 1639128..1640381 - 1254 WP_074976580.1 high-affinity branched-chain amino acid ABC transporter permease LivM -
NOX82_RS07560 (NOX82_07560) 1640378..1641298 - 921 WP_074976578.1 high-affinity branched-chain amino acid ABC transporter permease LivH -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 15195.51 Da        Isoelectric Point: 6.9789

>T252599 WP_074976585.1 NZ_CP101752:c1637296-1636883 [Pseudomonas citronellolis]
MLKFMLDTNICIFTIKNKPQVVREAFNQHHGQLAISSVTLMELIYGAEKSSMPEHNLGIVEGFAARLEVLDYDGNAAAHT
GQLRAELARIGKPIGPYDQMIAGHARSRGLILVSNNLREFERVPGLRLEDWTVAPSP

Download         Length: 414 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8523.43 Da        Isoelectric Point: 4.3094

>AT252599 WP_009620639.1 NZ_CP101752:c1637526-1637296 [Pseudomonas citronellolis]
MEQGAVFQSNRSQAVRLPKAVALPEDVKRVDVVAIGRTRILTPAGESWDSWFDGENVSADFMSEREQPAEQEREGF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Z0IRR5

Antitoxin

Source ID Structure
AlphaFold DB A0A1A5DDH0

References