Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 1492879..1493487 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | NOX82_RS06865 | Protein ID | WP_253391583.1 |
Coordinates | 1492879..1493226 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | NOX82_RS06870 | Protein ID | WP_253391584.1 |
Coordinates | 1493236..1493487 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS06835 (NOX82_06835) | 1488655..1489512 | + | 858 | WP_256514519.1 | ORF6N domain-containing protein | - |
NOX82_RS06840 (NOX82_06840) | 1489524..1489925 | + | 402 | WP_256514520.1 | hypothetical protein | - |
NOX82_RS06845 (NOX82_06845) | 1489944..1490330 | + | 387 | WP_256514521.1 | DUF2513 domain-containing protein | - |
NOX82_RS06850 (NOX82_06850) | 1490347..1490652 | - | 306 | Protein_1348 | Presumed portal vertex protein | - |
NOX82_RS06855 (NOX82_06855) | 1490632..1491429 | + | 798 | Protein_1349 | contractile injection system protein, VgrG/Pvc8 family | - |
NOX82_RS06860 (NOX82_06860) | 1491469..1492323 | - | 855 | WP_256514522.1 | serine protease | - |
NOX82_RS06865 (NOX82_06865) | 1492879..1493226 | - | 348 | WP_253391583.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOX82_RS06870 (NOX82_06870) | 1493236..1493487 | - | 252 | WP_253391584.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NOX82_RS06875 (NOX82_06875) | 1493946..1495361 | + | 1416 | WP_256514526.1 | amino acid permease | - |
NOX82_RS06880 (NOX82_06880) | 1495487..1496023 | + | 537 | WP_061560836.1 | 2,4'-dihydroxyacetophenone dioxygenase family protein | - |
NOX82_RS06885 (NOX82_06885) | 1496080..1496985 | + | 906 | WP_043272449.1 | LysR family transcriptional regulator | - |
NOX82_RS06890 (NOX82_06890) | 1497048..1498289 | + | 1242 | WP_256514528.1 | aminotransferase class III-fold pyridoxal phosphate-dependent enzyme | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12977.83 Da Isoelectric Point: 4.6337
>T252598 WP_253391583.1 NZ_CP101752:c1493226-1492879 [Pseudomonas citronellolis]
MSKLVIRLTDTAEQSIEDQVHHLVQFQGSQAALQSVLSLLDEIEEKISLTPQGYPISQQASLLGVLNYRELNTGPYRVFY
ELHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIG
MSKLVIRLTDTAEQSIEDQVHHLVQFQGSQAALQSVLSLLDEIEEKISLTPQGYPISQQASLLGVLNYRELNTGPYRVFY
ELHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIG
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|