Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1093081..1093550 Replicon chromosome
Accession NZ_CP101752
Organism Pseudomonas citronellolis strain C12

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NOX82_RS05060 Protein ID WP_116422667.1
Coordinates 1093081..1093356 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NOX82_RS05065 Protein ID WP_116422666.1
Coordinates 1093356..1093550 (-) Length 65 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOX82_RS05025 (NOX82_05025) 1088798..1090096 - 1299 WP_256514299.1 NAD(P)/FAD-dependent oxidoreductase -
NOX82_RS05030 (NOX82_05030) 1090143..1090316 - 174 WP_009617611.1 DUF3094 family protein -
NOX82_RS05035 (NOX82_05035) 1090386..1091015 - 630 WP_009617612.1 DUF1780 domain-containing protein -
NOX82_RS05040 (NOX82_05040) 1091148..1091564 + 417 WP_116422671.1 GNAT family N-acetyltransferase -
NOX82_RS05045 (NOX82_05045) 1091568..1092038 + 471 WP_249917810.1 FAD/FMN-containing dehydrogenase -
NOX82_RS05050 (NOX82_05050) 1092035..1092751 + 717 WP_256514304.1 energy-coupling factor ABC transporter permease -
NOX82_RS05055 (NOX82_05055) 1092859..1093074 + 216 WP_074977495.1 hypothetical protein -
NOX82_RS05060 (NOX82_05060) 1093081..1093356 - 276 WP_116422667.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NOX82_RS05065 (NOX82_05065) 1093356..1093550 - 195 WP_116422666.1 stability determinant Antitoxin
NOX82_RS05070 (NOX82_05070) 1093825..1094034 - 210 WP_043272268.1 DNA gyrase inhibitor YacG -
NOX82_RS05075 (NOX82_05075) 1094031..1094639 - 609 WP_256514308.1 dephospho-CoA kinase -
NOX82_RS05080 (NOX82_05080) 1094713..1095585 - 873 WP_256514310.1 A24 family peptidase -
NOX82_RS05085 (NOX82_05085) 1095586..1096803 - 1218 WP_256514311.1 type II secretion system F family protein -
NOX82_RS05090 (NOX82_05090) 1096807..1098510 - 1704 WP_256514312.1 type IV-A pilus assembly ATPase PilB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10506.08 Da        Isoelectric Point: 7.3551

>T252597 WP_116422667.1 NZ_CP101752:c1093356-1093081 [Pseudomonas citronellolis]
VLSIIWRRSASDDLATILVYIANEDPQAARRLKERVESAVLPLAQHPYLYRHGRVPGTREVVVHPNYILVYRIDAECIEV
ISVLHSRQEYP

Download         Length: 276 bp

Antitoxin


Download         Length: 65 a.a.        Molecular weight: 7232.97 Da        Isoelectric Point: 4.9890

>AT252597 WP_116422666.1 NZ_CP101752:c1093550-1093356 [Pseudomonas citronellolis]
MSARLSPIVSEFETPEQAASHDRWVRQKVQKSLTDNQPGRPHDEVMADMDSIIAQAEARRQGND

Download         Length: 195 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References