Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1093081..1093550 | Replicon | chromosome |
| Accession | NZ_CP101752 | ||
| Organism | Pseudomonas citronellolis strain C12 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NOX82_RS05060 | Protein ID | WP_116422667.1 |
| Coordinates | 1093081..1093356 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NOX82_RS05065 | Protein ID | WP_116422666.1 |
| Coordinates | 1093356..1093550 (-) | Length | 65 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOX82_RS05025 (NOX82_05025) | 1088798..1090096 | - | 1299 | WP_256514299.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| NOX82_RS05030 (NOX82_05030) | 1090143..1090316 | - | 174 | WP_009617611.1 | DUF3094 family protein | - |
| NOX82_RS05035 (NOX82_05035) | 1090386..1091015 | - | 630 | WP_009617612.1 | DUF1780 domain-containing protein | - |
| NOX82_RS05040 (NOX82_05040) | 1091148..1091564 | + | 417 | WP_116422671.1 | GNAT family N-acetyltransferase | - |
| NOX82_RS05045 (NOX82_05045) | 1091568..1092038 | + | 471 | WP_249917810.1 | FAD/FMN-containing dehydrogenase | - |
| NOX82_RS05050 (NOX82_05050) | 1092035..1092751 | + | 717 | WP_256514304.1 | energy-coupling factor ABC transporter permease | - |
| NOX82_RS05055 (NOX82_05055) | 1092859..1093074 | + | 216 | WP_074977495.1 | hypothetical protein | - |
| NOX82_RS05060 (NOX82_05060) | 1093081..1093356 | - | 276 | WP_116422667.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NOX82_RS05065 (NOX82_05065) | 1093356..1093550 | - | 195 | WP_116422666.1 | stability determinant | Antitoxin |
| NOX82_RS05070 (NOX82_05070) | 1093825..1094034 | - | 210 | WP_043272268.1 | DNA gyrase inhibitor YacG | - |
| NOX82_RS05075 (NOX82_05075) | 1094031..1094639 | - | 609 | WP_256514308.1 | dephospho-CoA kinase | - |
| NOX82_RS05080 (NOX82_05080) | 1094713..1095585 | - | 873 | WP_256514310.1 | A24 family peptidase | - |
| NOX82_RS05085 (NOX82_05085) | 1095586..1096803 | - | 1218 | WP_256514311.1 | type II secretion system F family protein | - |
| NOX82_RS05090 (NOX82_05090) | 1096807..1098510 | - | 1704 | WP_256514312.1 | type IV-A pilus assembly ATPase PilB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10506.08 Da Isoelectric Point: 7.3551
>T252597 WP_116422667.1 NZ_CP101752:c1093356-1093081 [Pseudomonas citronellolis]
VLSIIWRRSASDDLATILVYIANEDPQAARRLKERVESAVLPLAQHPYLYRHGRVPGTREVVVHPNYILVYRIDAECIEV
ISVLHSRQEYP
VLSIIWRRSASDDLATILVYIANEDPQAARRLKERVESAVLPLAQHPYLYRHGRVPGTREVVVHPNYILVYRIDAECIEV
ISVLHSRQEYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|