Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 684002..684635 | Replicon | chromosome |
Accession | NZ_CP101752 | ||
Organism | Pseudomonas citronellolis strain C12 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NOX82_RS03040 | Protein ID | WP_058073290.1 |
Coordinates | 684002..684184 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A4Z0ILP9 |
Locus tag | NOX82_RS03045 | Protein ID | WP_058073289.1 |
Coordinates | 684213..684635 (+) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX82_RS03020 (NOX82_03020) | 681620..681778 | + | 159 | WP_009615518.1 | YqaE/Pmp3 family membrane protein | - |
NOX82_RS03025 (NOX82_03025) | 682095..682583 | - | 489 | WP_058073292.1 | Bro-N domain-containing protein | - |
NOX82_RS03030 (NOX82_03030) | 683042..683224 | + | 183 | WP_009615522.1 | type II toxin-antitoxin system HicA family toxin | - |
NOX82_RS03035 (NOX82_03035) | 683257..683661 | + | 405 | WP_009615524.1 | type II toxin-antitoxin system HicB family antitoxin | - |
NOX82_RS03040 (NOX82_03040) | 684002..684184 | + | 183 | WP_058073290.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NOX82_RS03045 (NOX82_03045) | 684213..684635 | + | 423 | WP_058073289.1 | helix-turn-helix domain-containing protein | Antitoxin |
NOX82_RS03050 (NOX82_03050) | 684660..685430 | - | 771 | WP_249917986.1 | NERD domain-containing protein | - |
NOX82_RS03060 (NOX82_03060) | 685701..689435 | - | 3735 | WP_256514060.1 | bifunctional diguanylate cyclase/phosphodiesterase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6975.02 Da Isoelectric Point: 10.2145
>T252595 WP_058073290.1 NZ_CP101752:684002-684184 [Pseudomonas citronellolis]
MKYSEFRRWLKSQGVQFEPGKGSHFKVYFGDNQTIFPDHGAKEMGEGLRKKIIKDLGLKD
MKYSEFRRWLKSQGVQFEPGKGSHFKVYFGDNQTIFPDHGAKEMGEGLRKKIIKDLGLKD
Download Length: 183 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15056.35 Da Isoelectric Point: 4.9092
>AT252595 WP_058073289.1 NZ_CP101752:684213-684635 [Pseudomonas citronellolis]
MFDYPVTVHHEAGSVWVSCDDVPELASAGDTEEEALLDAIDGLETALSMYVERKVPIPLPSRAAPGQPVVCLPALTAAKA
ALWNAMQAQGVNKAEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALAVLGQRIALTVIAA
MFDYPVTVHHEAGSVWVSCDDVPELASAGDTEEEALLDAIDGLETALSMYVERKVPIPLPSRAAPGQPVVCLPALTAAKA
ALWNAMQAQGVNKAEMARRLGVNRPQVDRLVDLLHRSKIEQVEHALAVLGQRIALTVIAA
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|