Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 143098..143603 Replicon chromosome
Accession NZ_CP101752
Organism Pseudomonas citronellolis strain C12

Toxin (Protein)


Gene name parE Uniprot ID W5IQ81
Locus tag NOX82_RS00635 Protein ID WP_009614629.1
Coordinates 143098..143379 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID W5IQE2
Locus tag NOX82_RS00640 Protein ID WP_009614631.1
Coordinates 143376..143603 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOX82_RS00605 (NOX82_00605) 138431..139633 + 1203 WP_074980504.1 zinc metallochaperone GTPase ZigA -
NOX82_RS00610 (NOX82_00610) 139633..140250 + 618 WP_256513666.1 DUF1826 domain-containing protein -
NOX82_RS00615 (NOX82_00615) 140247..140702 - 456 WP_256513667.1 GNAT family N-acetyltransferase -
NOX82_RS00620 (NOX82_00620) 140761..141678 - 918 WP_256513668.1 LysR family transcriptional regulator -
NOX82_RS00625 (NOX82_00625) 141776..142057 + 282 WP_256513669.1 DUF2218 domain-containing protein -
NOX82_RS00630 (NOX82_00630) 142107..142838 - 732 WP_256513671.1 RcnB family protein -
NOX82_RS00635 (NOX82_00635) 143098..143379 - 282 WP_009614629.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NOX82_RS00640 (NOX82_00640) 143376..143603 - 228 WP_009614631.1 CopG family ribbon-helix-helix protein Antitoxin
NOX82_RS00645 (NOX82_00645) 143884..144840 + 957 WP_256513672.1 agmatinase -
NOX82_RS00650 (NOX82_00650) 144915..145841 + 927 WP_256513673.1 LysR family transcriptional regulator -
NOX82_RS00655 (NOX82_00655) 145838..146569 + 732 WP_256513674.1 phytanoyl-CoA dioxygenase family protein -
NOX82_RS00660 (NOX82_00660) 146581..146982 + 402 WP_256513675.1 GFA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10251.74 Da        Isoelectric Point: 6.4614

>T252593 WP_009614629.1 NZ_CP101752:c143379-143098 [Pseudomonas citronellolis]
MSLQWTHKAAADLDGLYDHYVVLIGPEKALKAIQDVVGQVKALADLSLSSVGRPSEVPGVRELPLERWPYQAAYRVKGRD
VQILRIDSVDNPG

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8357.42 Da        Isoelectric Point: 6.6405

>AT252593 WP_009614631.1 NZ_CP101752:c143603-143376 [Pseudomonas citronellolis]
MTTVISFRADDALAKALDQLARATHRDRPYHLRQALAQYLERQSWHVAAIDEGLADANAGHLLPHAEIEAKWGLA

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1A5D1B8

Antitoxin

Source ID Structure
AlphaFold DB A0A1S1GJG7

References