Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 5648022..5648547 | Replicon | chromosome |
Accession | NZ_CP101750 | ||
Organism | Streptomyces sp. Je 1-369 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NOO62_RS25885 | Protein ID | WP_268773250.1 |
Coordinates | 5648022..5648285 (-) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NOO62_RS25890 | Protein ID | WP_268773251.1 |
Coordinates | 5648278..5648547 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOO62_RS25865 (NOO62_25885) | 5644086..5645078 | + | 993 | WP_268773246.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
NOO62_RS25870 (NOO62_25890) | 5645130..5645870 | + | 741 | WP_268773247.1 | ROK family protein | - |
NOO62_RS25875 (NOO62_25895) | 5645887..5646396 | - | 510 | WP_268773248.1 | hypothetical protein | - |
NOO62_RS25880 (NOO62_25900) | 5646798..5647886 | + | 1089 | WP_268773249.1 | redox-regulated ATPase YchF | - |
NOO62_RS25885 (NOO62_25905) | 5648022..5648285 | - | 264 | WP_268773250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOO62_RS25890 (NOO62_25910) | 5648278..5648547 | - | 270 | WP_268773251.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NOO62_RS25895 (NOO62_25915) | 5648663..5648830 | + | 168 | WP_268775984.1 | hypothetical protein | - |
NOO62_RS25900 (NOO62_25920) | 5648836..5648919 | + | 84 | Protein_5106 | type II toxin-antitoxin system YoeB family toxin | - |
NOO62_RS25905 (NOO62_25925) | 5648973..5650442 | + | 1470 | WP_268773252.1 | amidase | - |
NOO62_RS25910 (NOO62_25930) | 5650400..5651362 | - | 963 | WP_268773253.1 | CU044_5270 family protein | - |
NOO62_RS25915 (NOO62_25935) | 5651359..5651973 | - | 615 | WP_268773254.1 | RNA polymerase sigma factor | - |
NOO62_RS25920 (NOO62_25940) | 5652023..5653168 | - | 1146 | WP_268773255.1 | threonine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10034.43 Da Isoelectric Point: 7.0123
>T252592 WP_268773250.1 NZ_CP101750:c5648285-5648022 [Streptomyces sp. Je 1-369]
VSEYRTVFRPEAQDELRKIPRAMALRILAKLTELESDPLGFNTTALVSQPERRRLRVGDYRVVYTIDNGELVVWVVHVGD
RSTAYET
VSEYRTVFRPEAQDELRKIPRAMALRILAKLTELESDPLGFNTTALVSQPERRRLRVGDYRVVYTIDNGELVVWVVHVGD
RSTAYET
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|