Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 13938..14421 Replicon plasmid unnamed5
Accession NZ_CP101748
Organism Comamonas sp. C11

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag NOX35_RS28525 Protein ID WP_256497111.1
Coordinates 13938..14210 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID -
Locus tag NOX35_RS28530 Protein ID WP_182312697.1
Coordinates 14194..14421 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOX35_RS28495 (NOX35_28495) 9637..10071 + 435 WP_256497127.1 conjugal transfer protein TraD -
NOX35_RS28500 (NOX35_28500) 10131..10304 + 174 WP_256497107.1 hypothetical protein -
NOX35_RS28505 (NOX35_28505) 10310..11248 - 939 WP_256497108.1 DNA-binding protein -
NOX35_RS28510 (NOX35_28510) 11842..12798 - 957 WP_256497109.1 replication initiation protein -
NOX35_RS28515 (NOX35_28515) 13073..13711 + 639 WP_198462398.1 ParA family partition ATPase -
NOX35_RS28520 (NOX35_28520) 13702..13905 + 204 WP_256497110.1 hypothetical protein -
NOX35_RS28525 (NOX35_28525) 13938..14210 - 273 WP_256497111.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NOX35_RS28530 (NOX35_28530) 14194..14421 - 228 WP_182312697.1 TraY domain-containing protein Antitoxin
NOX35_RS28535 (NOX35_28535) 14560..14943 - 384 WP_256497112.1 autotransporter domain-containing protein -
NOX35_RS28540 (NOX35_28540) 15000..15773 - 774 WP_256497113.1 IclR family transcriptional regulator -
NOX35_RS28545 (NOX35_28545) 15906..16325 + 420 WP_256497114.1 hypothetical protein -
NOX35_RS28550 (NOX35_28550) 16337..17464 + 1128 WP_256497115.1 thiolase family protein -
NOX35_RS28555 (NOX35_28555) 17482..18276 + 795 WP_256497116.1 enoyl-CoA hydratase-related protein -
NOX35_RS28560 (NOX35_28560) 18319..19119 + 801 WP_256497117.1 SDR family oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..19871 19871


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-88)

Antitoxin

Relaxosome protein TraY

(3-49)


Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10370.00 Da        Isoelectric Point: 10.2187

>T252591 WP_256497111.1 NZ_CP101748:c14210-13938 [Comamonas sp. C11]
MAWQIELSEGAVKNLKQLDHQHARRILSFLHGRVAQLDDPRSIGEALKGSKLGELWKYRVGDYRIIADIEDGVMRVLVLK
VGNRREVYRS

Download         Length: 273 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8557.80 Da        Isoelectric Point: 5.1023

>AT252591 WP_182312697.1 NZ_CP101748:c14421-14194 [Comamonas sp. C11]
MSVSLRLPPELNQRLSHLAEQTGRSKTFYMLEAIKQHLDDLEDVYLAERELEAVRAGKSKAVPLEEVMKQYGLAD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References