Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2874712..2875313 | Replicon | chromosome |
Accession | NZ_CP101743 | ||
Organism | Comamonas sp. C11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NOX35_RS13145 | Protein ID | WP_019042333.1 |
Coordinates | 2874712..2875098 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A076PMR1 |
Locus tag | NOX35_RS13150 | Protein ID | WP_034356765.1 |
Coordinates | 2875098..2875313 (-) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOX35_RS13130 (NOX35_13130) | 2872179..2873489 | - | 1311 | WP_256496868.1 | DNA polymerase Y family protein | - |
NOX35_RS13135 (NOX35_13135) | 2873434..2874234 | - | 801 | WP_256496869.1 | translesion DNA synthesis-associated protein ImuA | - |
NOX35_RS13140 (NOX35_13140) | 2874414..2874623 | - | 210 | WP_034356767.1 | hypothetical protein | - |
NOX35_RS13145 (NOX35_13145) | 2874712..2875098 | - | 387 | WP_019042333.1 | twitching motility protein PilT | Toxin |
NOX35_RS13150 (NOX35_13150) | 2875098..2875313 | - | 216 | WP_034356765.1 | DUF2191 domain-containing protein | Antitoxin |
NOX35_RS13155 (NOX35_13155) | 2875398..2876215 | + | 818 | Protein_2543 | SprT-like domain-containing protein | - |
NOX35_RS13160 (NOX35_13160) | 2876369..2876695 | + | 327 | WP_019042331.1 | transposase | - |
NOX35_RS13165 (NOX35_13165) | 2877032..2878705 | - | 1674 | WP_230629841.1 | phosphoethanolamine transferase | - |
NOX35_RS13170 (NOX35_13170) | 2878957..2879346 | + | 390 | WP_080571250.1 | CzcE family metal-binding protein | - |
NOX35_RS13175 (NOX35_13175) | 2879426..2879872 | - | 447 | WP_019042328.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2610723..2909723 | 299000 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 13999.29 Da Isoelectric Point: 5.0594
>T252588 WP_019042333.1 NZ_CP101743:c2875098-2874712 [Comamonas sp. C11]
MPVSVLVDTSVWVRHFREADTHLQELLMQDSVLMHSMVHAELACGTPPAPRADTLAALAMLRPSQEASIPETLEFLEQNK
LFGKGCGLVDLSLLASTLITPGALLWTADRRLADMATQLNVAYLPPLH
MPVSVLVDTSVWVRHFREADTHLQELLMQDSVLMHSMVHAELACGTPPAPRADTLAALAMLRPSQEASIPETLEFLEQNK
LFGKGCGLVDLSLLASTLITPGALLWTADRRLADMATQLNVAYLPPLH
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|