Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 2833553..2834073 | Replicon | chromosome |
| Accession | NZ_CP101740 | ||
| Organism | Sphingomonas qomolangmaensis strain S5-59 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NMP03_RS13550 | Protein ID | WP_256505985.1 |
| Coordinates | 2833750..2834073 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NMP03_RS13545 | Protein ID | WP_256505984.1 |
| Coordinates | 2833553..2833753 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMP03_RS13535 (NMP03_13535) | 2829375..2830859 | - | 1485 | WP_256505982.1 | HWE histidine kinase domain-containing protein | - |
| NMP03_RS13540 (NMP03_13540) | 2830940..2833141 | - | 2202 | WP_256505983.1 | excinuclease ABC subunit UvrB | - |
| NMP03_RS13545 (NMP03_13545) | 2833553..2833753 | + | 201 | WP_256505984.1 | antitoxin MazE family protein | Antitoxin |
| NMP03_RS13550 (NMP03_13550) | 2833750..2834073 | + | 324 | WP_256505985.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NMP03_RS13555 (NMP03_13555) | 2834319..2835644 | + | 1326 | WP_256505986.1 | amidohydrolase | - |
| NMP03_RS13560 (NMP03_13560) | 2835803..2836990 | - | 1188 | WP_256505987.1 | MBL fold metallo-hydrolase | - |
| NMP03_RS13565 (NMP03_13565) | 2837168..2838691 | - | 1524 | WP_256505988.1 | fumarate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 11329.38 Da Isoelectric Point: 11.0199
>T252587 WP_256505985.1 NZ_CP101740:2833750-2834073 [Sphingomonas qomolangmaensis]
MKRGDLVTIALPGDFGKPRPALIIQSDQFDQTGTVTVLLVSGTLVDAPLIRTTIDPTPGNGLRKRSQVMVDKAMSVKRGK
IGAPIGRLDAEAMLAVTRALAVFFAIA
MKRGDLVTIALPGDFGKPRPALIIQSDQFDQTGTVTVLLVSGTLVDAPLIRTTIDPTPGNGLRKRSQVMVDKAMSVKRGK
IGAPIGRLDAEAMLAVTRALAVFFAIA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|