Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 2508688..2509156 | Replicon | chromosome |
| Accession | NZ_CP101740 | ||
| Organism | Sphingomonas qomolangmaensis strain S5-59 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | - |
| Locus tag | NMP03_RS11915 | Protein ID | WP_256505634.1 |
| Coordinates | 2508890..2509156 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | - |
| Locus tag | NMP03_RS11910 | Protein ID | WP_256505633.1 |
| Coordinates | 2508688..2508906 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMP03_RS11870 (NMP03_11870) | 2503867..2505123 | - | 1257 | WP_256505624.1 | aspartate kinase | - |
| NMP03_RS11875 (NMP03_11875) | 2505176..2505901 | + | 726 | WP_256505625.1 | bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG | - |
| NMP03_RS11880 (NMP03_11880) | 2505917..2506288 | - | 372 | WP_256505627.1 | tRNA-binding protein | - |
| NMP03_RS11885 (NMP03_11885) | 2506372..2506656 | + | 285 | WP_256508112.1 | DUF427 domain-containing protein | - |
| NMP03_RS11890 (NMP03_11890) | 2506653..2506952 | + | 300 | WP_256505628.1 | alkylphosphonate utilization protein | - |
| NMP03_RS11895 (NMP03_11895) | 2507018..2507143 | + | 126 | WP_256505629.1 | hypothetical protein | - |
| NMP03_RS11900 (NMP03_11900) | 2507190..2507981 | - | 792 | WP_256505630.1 | hypothetical protein | - |
| NMP03_RS11905 (NMP03_11905) | 2508200..2508628 | + | 429 | WP_256505632.1 | cupin domain-containing protein | - |
| NMP03_RS11910 (NMP03_11910) | 2508688..2508906 | + | 219 | WP_256505633.1 | TraY domain-containing protein | Antitoxin |
| NMP03_RS11915 (NMP03_11915) | 2508890..2509156 | + | 267 | WP_256505634.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMP03_RS11920 (NMP03_11920) | 2509247..2509501 | + | 255 | WP_033920619.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| NMP03_RS11925 (NMP03_11925) | 2509498..2509764 | + | 267 | WP_256505635.1 | Txe/YoeB family addiction module toxin | - |
| NMP03_RS11930 (NMP03_11930) | 2509782..2510318 | - | 537 | WP_256505636.1 | hypothetical protein | - |
| NMP03_RS11935 (NMP03_11935) | 2510400..2510537 | - | 138 | WP_256505638.1 | hypothetical protein | - |
| NMP03_RS11940 (NMP03_11940) | 2510833..2511285 | + | 453 | WP_256505639.1 | hypothetical protein | - |
| NMP03_RS11945 (NMP03_11945) | 2511341..2513281 | - | 1941 | WP_256505640.1 | phosphomethylpyrimidine synthase ThiC | - |
| NMP03_RS11950 (NMP03_11950) | 2513434..2513778 | - | 345 | WP_256505641.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10153.70 Da Isoelectric Point: 10.0844
>T252584 WP_256505634.1 NZ_CP101740:2508890-2509156 [Sphingomonas qomolangmaensis]
MAWRIEFLPEAAKELAKLDRTAAARIIKTLETRIAVQDDPRSLGSTLTGDHAGYWRWQIGDYHVVARIEDDRVLILVVRV
AHRRGVYR
MAWRIEFLPEAAKELAKLDRTAAARIIKTLETRIAVQDDPRSLGSTLTGDHAGYWRWQIGDYHVVARIEDDRVLILVVRV
AHRRGVYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|