Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 145131..145774 Replicon plasmid pVir_150040X1B1
Accession NZ_CP101728
Organism Klebsiella pneumoniae strain 150040X1B1

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag NPN21_RS28665 Protein ID WP_001034046.1
Coordinates 145358..145774 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag NPN21_RS28660 Protein ID WP_001261278.1
Coordinates 145131..145361 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPN21_RS28630 (140641) 140641..140946 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
NPN21_RS28635 (140948) 140948..141166 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
NPN21_RS28640 (141758) 141758..142246 + 489 WP_011254646.1 hypothetical protein -
NPN21_RS28645 (142280) 142280..143413 - 1134 WP_000545984.1 DUF3800 domain-containing protein -
NPN21_RS28650 (143580) 143580..144353 - 774 WP_000905949.1 hypothetical protein -
NPN21_RS28655 (144366) 144366..144866 - 501 WP_000528932.1 HEPN family nuclease -
NPN21_RS28660 (145131) 145131..145361 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPN21_RS28665 (145358) 145358..145774 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
NPN21_RS28670 (145819) 145819..149613 - 3795 WP_001144731.1 hypothetical protein -
NPN21_RS28675 (149994) 149994..150224 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NPN21_RS28680 (150221) 150221..150637 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..172348 172348


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T252579 WP_001034046.1 NZ_CP101728:145358-145774 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT252579 WP_001261278.1 NZ_CP101728:145131-145361 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References