Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 145131..145774 | Replicon | plasmid pVir_150040X1B1 |
| Accession | NZ_CP101728 | ||
| Organism | Klebsiella pneumoniae strain 150040X1B1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | NPN21_RS28665 | Protein ID | WP_001034046.1 |
| Coordinates | 145358..145774 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | NPN21_RS28660 | Protein ID | WP_001261278.1 |
| Coordinates | 145131..145361 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPN21_RS28630 (140641) | 140641..140946 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
| NPN21_RS28635 (140948) | 140948..141166 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| NPN21_RS28640 (141758) | 141758..142246 | + | 489 | WP_011254646.1 | hypothetical protein | - |
| NPN21_RS28645 (142280) | 142280..143413 | - | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
| NPN21_RS28650 (143580) | 143580..144353 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| NPN21_RS28655 (144366) | 144366..144866 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
| NPN21_RS28660 (145131) | 145131..145361 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPN21_RS28665 (145358) | 145358..145774 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPN21_RS28670 (145819) | 145819..149613 | - | 3795 | WP_001144731.1 | hypothetical protein | - |
| NPN21_RS28675 (149994) | 149994..150224 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NPN21_RS28680 (150221) | 150221..150637 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..172348 | 172348 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T252579 WP_001034046.1 NZ_CP101728:145358-145774 [Klebsiella pneumoniae]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |