Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 140641..141166 | Replicon | plasmid pVir_150040X1B1 |
Accession | NZ_CP101728 | ||
Organism | Klebsiella pneumoniae strain 150040X1B1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | NPN21_RS28630 | Protein ID | WP_001159868.1 |
Coordinates | 140641..140946 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | NPN21_RS28635 | Protein ID | WP_000813634.1 |
Coordinates | 140948..141166 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPN21_RS28615 (136573) | 136573..137739 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
NPN21_RS28620 (138327) | 138327..139082 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
NPN21_RS28625 (139834) | 139834..140640 | - | 807 | WP_000016982.1 | site-specific integrase | - |
NPN21_RS28630 (140641) | 140641..140946 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NPN21_RS28635 (140948) | 140948..141166 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NPN21_RS28640 (141758) | 141758..142246 | + | 489 | WP_011254646.1 | hypothetical protein | - |
NPN21_RS28645 (142280) | 142280..143413 | - | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
NPN21_RS28650 (143580) | 143580..144353 | - | 774 | WP_000905949.1 | hypothetical protein | - |
NPN21_RS28655 (144366) | 144366..144866 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
NPN21_RS28660 (145131) | 145131..145361 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NPN21_RS28665 (145358) | 145358..145774 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..172348 | 172348 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T252578 WP_001159868.1 NZ_CP101728:c140946-140641 [Klebsiella pneumoniae]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|