Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 142714..143357 Replicon plasmid pCTXM65_150040X1B1
Accession NZ_CP101727
Organism Klebsiella pneumoniae strain 150040X1B1

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NPN21_RS27830 Protein ID WP_001044770.1
Coordinates 142714..143130 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NPN21_RS27835 Protein ID WP_001261282.1
Coordinates 143127..143357 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPN21_RS27805 (137798) 137798..138157 + 360 WP_015493069.1 hypothetical protein -
NPN21_RS27810 (138783) 138783..139157 + 375 WP_008324180.1 hypothetical protein -
NPN21_RS27815 (139283) 139283..139987 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
NPN21_RS27820 (140071) 140071..141093 - 1023 WP_000361404.1 helicase UvrD -
NPN21_RS27825 (141078) 141078..142640 - 1563 WP_004206609.1 AAA family ATPase -
NPN21_RS27830 (142714) 142714..143130 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NPN21_RS27835 (143127) 143127..143357 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPN21_RS27840 (143314) 143314..143775 + 462 WP_014343465.1 hypothetical protein -
NPN21_RS27845 (143936) 143936..144880 + 945 WP_011977810.1 hypothetical protein -
NPN21_RS27850 (144917) 144917..145309 + 393 WP_011977811.1 hypothetical protein -
NPN21_RS27855 (145367) 145367..145888 + 522 WP_013214008.1 hypothetical protein -
NPN21_RS27860 (145934) 145934..146137 + 204 WP_011977813.1 hypothetical protein -
NPN21_RS27865 (146167) 146167..147171 + 1005 WP_011977814.1 hypothetical protein -
NPN21_RS27870 (147355) 147355..148134 + 780 WP_013214009.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-65 - 1..149214 149214
- flank IS/Tn - - 139283..139987 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T252572 WP_001044770.1 NZ_CP101727:c143130-142714 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT252572 WP_001261282.1 NZ_CP101727:c143357-143127 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References