Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1421133..1422049 | Replicon | chromosome |
Accession | NZ_CP101718 | ||
Organism | Bacillus halotolerans strain S-5 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NPA28_RS07255 | Protein ID | WP_044156223.1 |
Coordinates | 1421303..1422049 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | NPA28_RS07250 | Protein ID | WP_024121090.1 |
Coordinates | 1421133..1421303 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPA28_RS07215 (NPA28_07215) | 1417997..1418326 | + | 330 | WP_044156231.1 | XkdW family protein | - |
NPA28_RS07220 (NPA28_07220) | 1418323..1418487 | + | 165 | WP_044156230.1 | XkdX family protein | - |
NPA28_RS07225 (NPA28_07225) | 1418531..1419370 | + | 840 | WP_044156229.1 | hypothetical protein | - |
NPA28_RS07230 (NPA28_07230) | 1419426..1419695 | + | 270 | WP_044156228.1 | hemolysin XhlA family protein | - |
NPA28_RS07235 (NPA28_07235) | 1419707..1419970 | + | 264 | WP_044156226.1 | phage holin | - |
NPA28_RS07240 (NPA28_07240) | 1419983..1420876 | + | 894 | WP_217827104.1 | N-acetylmuramoyl-L-alanine amidase | - |
NPA28_RS07245 (NPA28_07245) | 1420912..1421049 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NPA28_RS07250 (NPA28_07250) | 1421133..1421303 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NPA28_RS07255 (NPA28_07255) | 1421303..1422049 | - | 747 | WP_044156223.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NPA28_RS07260 (NPA28_07260) | 1422158..1423159 | - | 1002 | WP_044156221.1 | inorganic phosphate transporter | - |
NPA28_RS07265 (NPA28_07265) | 1423172..1423789 | - | 618 | WP_044156219.1 | DUF47 domain-containing protein | - |
NPA28_RS07270 (NPA28_07270) | 1424068..1425384 | - | 1317 | WP_044156218.1 | serine/threonine exchanger | - |
NPA28_RS07275 (NPA28_07275) | 1425779..1426729 | + | 951 | WP_059292934.1 | ring-cleaving dioxygenase | - |
NPA28_RS07280 (NPA28_07280) | 1426895..1426975 | + | 81 | Protein_1371 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29102.52 Da Isoelectric Point: 4.4373
>T252550 WP_044156223.1 NZ_CP101718:c1422049-1421303 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CYYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CYYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|