Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 518381..519017 | Replicon | chromosome |
Accession | NZ_CP101718 | ||
Organism | Bacillus halotolerans strain S-5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NPA28_RS02655 | Protein ID | WP_003156187.1 |
Coordinates | 518667..519017 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NPA28_RS02650 | Protein ID | WP_003225183.1 |
Coordinates | 518381..518662 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPA28_RS02630 (NPA28_02630) | 514738..515337 | - | 600 | WP_044161737.1 | rhomboid family intramembrane serine protease | - |
NPA28_RS02635 (NPA28_02635) | 515432..515797 | + | 366 | WP_256766654.1 | holo-ACP synthase | - |
NPA28_RS02640 (NPA28_02640) | 515963..516979 | + | 1017 | WP_256766957.1 | outer membrane lipoprotein carrier protein LolA | - |
NPA28_RS02645 (NPA28_02645) | 517096..518265 | + | 1170 | WP_044161733.1 | alanine racemase | - |
NPA28_RS02650 (NPA28_02650) | 518381..518662 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NPA28_RS02655 (NPA28_02655) | 518667..519017 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NPA28_RS02660 (NPA28_02660) | 519133..519957 | + | 825 | WP_082687807.1 | RsbT co-antagonist protein RsbRA | - |
NPA28_RS02665 (NPA28_02665) | 519962..520327 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NPA28_RS02670 (NPA28_02670) | 520331..520732 | + | 402 | WP_024714447.1 | serine/threonine-protein kinase RsbT | - |
NPA28_RS02675 (NPA28_02675) | 520744..521751 | + | 1008 | WP_044161721.1 | phosphoserine phosphatase RsbU | - |
NPA28_RS02680 (NPA28_02680) | 521812..522141 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
NPA28_RS02685 (NPA28_02685) | 522138..522620 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
NPA28_RS02690 (NPA28_02690) | 522586..523374 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
NPA28_RS02695 (NPA28_02695) | 523374..523973 | + | 600 | WP_217828106.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T252549 WP_003156187.1 NZ_CP101718:518667-519017 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|