Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 199767..200292 Replicon plasmid pOXA1041_035152
Accession NZ_CP101706
Organism Escherichia coli strain 035152

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NPL72_RS24815 Protein ID WP_001159871.1
Coordinates 199767..200072 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NPL72_RS24820 Protein ID WP_000813630.1
Coordinates 200074..200292 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPL72_RS24800 (195729) 195729..196895 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
NPL72_RS24805 (197483) 197483..198238 - 756 WP_000852146.1 replication initiation protein RepE -
NPL72_RS24810 (198960) 198960..199766 - 807 WP_000016970.1 site-specific integrase -
NPL72_RS24815 (199767) 199767..200072 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NPL72_RS24820 (200074) 200074..200292 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NPL72_RS24825 (200852) 200852..201082 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NPL72_RS24830 (201079) 201079..201495 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
NPL72_RS24835 (201570) 201570..203135 + 1566 WP_001128474.1 AAA family ATPase -
NPL72_RS24840 (203120) 203120..204142 + 1023 WP_000361402.1 helicase UvrD -
NPL72_RS24845 (204396) 204396..205082 - 687 Protein_239 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / qacE / sul1 / blaOXA-427 / qnrA1 / floR / tet(G) / rmtB / blaTEM-1B / tet(A) / sitABCD senB / iutA / iucD / iucC / iucB / iucA 1..223341 223341
- flank IS/Tn - - 204396..204743 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T252547 WP_001159871.1 NZ_CP101706:c200072-199767 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT252547 WP_000813630.1 NZ_CP101706:c200292-200074 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References