Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1924039..1924871 | Replicon | chromosome |
| Accession | NZ_CP101705 | ||
| Organism | Escherichia coli strain 035152 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0Q2Y5N3 |
| Locus tag | NPL72_RS09230 | Protein ID | WP_001514886.1 |
| Coordinates | 1924039..1924413 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7U9IW59 |
| Locus tag | NPL72_RS09235 | Protein ID | WP_001360327.1 |
| Coordinates | 1924503..1924871 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPL72_RS09195 (1919555) | 1919555..1920028 | + | 474 | WP_001105385.1 | DNA gyrase inhibitor SbmC | - |
| NPL72_RS09200 (1920227) | 1920227..1921285 | + | 1059 | WP_032181141.1 | FUSC family protein | - |
| NPL72_RS09205 (1921457) | 1921457..1921786 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| NPL72_RS09210 (1921887) | 1921887..1922153 | - | 267 | WP_063121129.1 | EutP/PduV family microcompartment system protein | - |
| NPL72_RS09215 (1922523) | 1922523..1922912 | - | 390 | WP_001445118.1 | IS110 family transposase | - |
| NPL72_RS09220 (1923710) | 1923710..1923790 | - | 81 | Protein_1805 | hypothetical protein | - |
| NPL72_RS09225 (1923890) | 1923890..1924042 | - | 153 | Protein_1806 | DUF5983 family protein | - |
| NPL72_RS09230 (1924039) | 1924039..1924413 | - | 375 | WP_001514886.1 | TA system toxin CbtA family protein | Toxin |
| NPL72_RS09235 (1924503) | 1924503..1924871 | - | 369 | WP_001360327.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NPL72_RS09240 (1925034) | 1925034..1925255 | - | 222 | WP_000692286.1 | DUF987 domain-containing protein | - |
| NPL72_RS09245 (1925318) | 1925318..1925794 | - | 477 | WP_001186747.1 | RadC family protein | - |
| NPL72_RS09250 (1925810) | 1925810..1926283 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| NPL72_RS09255 (1926625) | 1926625..1927446 | - | 822 | WP_001234565.1 | DUF932 domain-containing protein | - |
| NPL72_RS09260 (1927565) | 1927565..1927760 | - | 196 | Protein_1813 | DUF905 family protein | - |
| NPL72_RS09265 (1927831) | 1927831..1929639 | - | 1809 | WP_185160903.1 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13930.91 Da Isoelectric Point: 7.2909
>T252534 WP_001514886.1 NZ_CP101705:c1924413-1924039 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.34 Da Isoelectric Point: 5.9598
>AT252534 WP_001360327.1 NZ_CP101705:c1924871-1924503 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q2Y5N3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9IW59 |