Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 835966..836764 | Replicon | chromosome |
| Accession | NZ_CP101705 | ||
| Organism | Escherichia coli strain 035152 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | U9XMP3 |
| Locus tag | NPL72_RS04085 | Protein ID | WP_000854735.1 |
| Coordinates | 835966..836343 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1EW42 |
| Locus tag | NPL72_RS04090 | Protein ID | WP_032153712.1 |
| Coordinates | 836390..836764 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPL72_RS04050 (831529) | 831529..832707 | + | 1179 | WP_000094970.1 | type II secretion system protein GspL | - |
| NPL72_RS04055 (832709) | 832709..833245 | + | 537 | WP_000942786.1 | GspM family type II secretion system protein YghD | - |
| NPL72_RS04060 (833660) | 833660..833986 | - | 327 | WP_000779483.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NPL72_RS04065 (833983) | 833983..834246 | - | 264 | WP_025492088.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| NPL72_RS04070 (834318) | 834318..835184 | - | 867 | WP_032153714.1 | DUF4942 domain-containing protein | - |
| NPL72_RS04075 (835269) | 835269..835466 | - | 198 | WP_000839265.1 | DUF957 domain-containing protein | - |
| NPL72_RS04080 (835478) | 835478..835969 | - | 492 | WP_023155722.1 | DUF5983 family protein | - |
| NPL72_RS04085 (835966) | 835966..836343 | - | 378 | WP_000854735.1 | TA system toxin CbtA family protein | Toxin |
| NPL72_RS04090 (836390) | 836390..836764 | - | 375 | WP_032153712.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NPL72_RS04095 (836844) | 836844..837065 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NPL72_RS04100 (837134) | 837134..837610 | - | 477 | WP_001186715.1 | RadC family protein | - |
| NPL72_RS04105 (837626) | 837626..838111 | - | 486 | WP_032153711.1 | antirestriction protein | - |
| NPL72_RS04110 (838203) | 838203..839021 | - | 819 | WP_001234693.1 | DUF932 domain-containing protein | - |
| NPL72_RS04115 (839112) | 839112..839321 | - | 210 | WP_023155727.1 | DUF905 family protein | - |
| NPL72_RS04120 (839351) | 839351..840028 | - | 678 | WP_023155728.1 | hypothetical protein | - |
| NPL72_RS04125 (840147) | 840147..841031 | - | 885 | WP_024166630.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | papI / papB | 833983..903877 | 69894 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14061.07 Da Isoelectric Point: 8.2904
>T252528 WP_000854735.1 NZ_CP101705:c836343-835966 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13697.51 Da Isoelectric Point: 6.6240
>AT252528 WP_032153712.1 NZ_CP101705:c836764-836390 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9XMP3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1EW42 |