Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 835966..836764 Replicon chromosome
Accession NZ_CP101705
Organism Escherichia coli strain 035152

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag NPL72_RS04085 Protein ID WP_000854735.1
Coordinates 835966..836343 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M1EW42
Locus tag NPL72_RS04090 Protein ID WP_032153712.1
Coordinates 836390..836764 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPL72_RS04050 (831529) 831529..832707 + 1179 WP_000094970.1 type II secretion system protein GspL -
NPL72_RS04055 (832709) 832709..833245 + 537 WP_000942786.1 GspM family type II secretion system protein YghD -
NPL72_RS04060 (833660) 833660..833986 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
NPL72_RS04065 (833983) 833983..834246 - 264 WP_025492088.1 type II toxin-antitoxin system ParD family antitoxin -
NPL72_RS04070 (834318) 834318..835184 - 867 WP_032153714.1 DUF4942 domain-containing protein -
NPL72_RS04075 (835269) 835269..835466 - 198 WP_000839265.1 DUF957 domain-containing protein -
NPL72_RS04080 (835478) 835478..835969 - 492 WP_023155722.1 DUF5983 family protein -
NPL72_RS04085 (835966) 835966..836343 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
NPL72_RS04090 (836390) 836390..836764 - 375 WP_032153712.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NPL72_RS04095 (836844) 836844..837065 - 222 WP_000692345.1 DUF987 domain-containing protein -
NPL72_RS04100 (837134) 837134..837610 - 477 WP_001186715.1 RadC family protein -
NPL72_RS04105 (837626) 837626..838111 - 486 WP_032153711.1 antirestriction protein -
NPL72_RS04110 (838203) 838203..839021 - 819 WP_001234693.1 DUF932 domain-containing protein -
NPL72_RS04115 (839112) 839112..839321 - 210 WP_023155727.1 DUF905 family protein -
NPL72_RS04120 (839351) 839351..840028 - 678 WP_023155728.1 hypothetical protein -
NPL72_RS04125 (840147) 840147..841031 - 885 WP_024166630.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR papI / papB 833983..903877 69894


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T252528 WP_000854735.1 NZ_CP101705:c836343-835966 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13697.51 Da        Isoelectric Point: 6.6240

>AT252528 WP_032153712.1 NZ_CP101705:c836764-836390 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1EW42

References