Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 2863597..2864153 Replicon chromosome
Accession NZ_CP101704
Organism Xanthomonas oryzae pv. oryzae strain CIX4462

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NO461_RS13425 Protein ID WP_229001948.1
Coordinates 2863597..2863848 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A854CIX2
Locus tag NO461_RS13430 Protein ID WP_011408759.1
Coordinates 2863875..2864153 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO461_RS13375 (NO461_13380) 2859703..2860019 - 317 Protein_2576 ATP-dependent DNA ligase -
NO461_RS13380 (NO461_13385) 2860301..2860477 - 177 Protein_2577 DUF3606 domain-containing protein -
NO461_RS13385 (NO461_13390) 2860699..2861100 + 402 WP_011259345.1 H-NS family nucleoid-associated regulatory protein -
NO461_RS13395 (NO461_13400) 2862043..2862044 - 2 WP_094187731.1 IS5 family transposase -
NO461_RS13400 (NO461_13405) 2862383..2862511 - 129 WP_012444694.1 hypothetical protein -
NO461_RS13405 (NO461_13410) 2862480..2862599 - 120 Protein_2581 IS3 family transposase -
NO461_RS13410 (NO461_13415) 2862816..2863070 - 255 WP_223293127.1 hypothetical protein -
NO461_RS13415 (NO461_13420) 2863139..2863273 - 135 WP_011051575.1 hypothetical protein -
NO461_RS13420 (NO461_13425) 2863266..2863520 - 255 WP_198912806.1 hypothetical protein -
NO461_RS13425 (NO461_13430) 2863597..2863848 - 252 WP_229001948.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NO461_RS13430 (NO461_13435) 2863875..2864153 - 279 WP_011408759.1 CopG family ribbon-helix-helix protein Antitoxin
NO461_RS13435 (NO461_13440) 2864349..2864693 - 345 WP_198912817.1 hypothetical protein -
NO461_RS13440 (NO461_13445) 2865599..2866783 - 1185 WP_011408522.1 IS256-like element IS1113 family transposase -
NO461_RS13445 (NO461_13450) 2867364..2868329 + 966 WP_109181928.1 IS1595-like element ISXo5 family transposase -
NO461_RS13450 (NO461_13455) 2868479..2869036 + 558 WP_011259349.1 DNA-3-methyladenine glycosylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 2861516..2868329 6813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-81)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9603.92 Da        Isoelectric Point: 9.9718

>T252521 WP_229001948.1 NZ_CP101704:c2863848-2863597 [Xanthomonas oryzae pv. oryzae]
MLRLREFLRPKNPDAARRAGEAIRRGVQALGAHPRMGRLIEDLSEQYREWLIDFGDSGYVARYRFDGDTVTILAVRHQKE
AGY

Download         Length: 252 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10826.11 Da        Isoelectric Point: 4.9736

>AT252521 WP_011408759.1 NZ_CP101704:c2864153-2863875 [Xanthomonas oryzae pv. oryzae]
MVTATSIKLDDELKGRVQHLAESRRRTPHWIMREAIEQYVEREEKREALNRDTLKAWDEFQATGLHVTAEEVDKWLASWG
TDDELPPPECHK

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A854CIX2

References