Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 2864662..2865218 Replicon chromosome
Accession NZ_CP101703
Organism Xanthomonas oryzae pv. oryzae strain CIX4506

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NO458_RS13415 Protein ID WP_229001948.1
Coordinates 2864662..2864913 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A854CIX2
Locus tag NO458_RS13420 Protein ID WP_011408759.1
Coordinates 2864940..2865218 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO458_RS13365 (NO458_13375) 2860768..2861084 - 317 Protein_2574 ATP-dependent DNA ligase -
NO458_RS13370 (NO458_13380) 2861366..2861542 - 177 Protein_2575 DUF3606 domain-containing protein -
NO458_RS13375 (NO458_13385) 2861764..2862165 + 402 WP_011259345.1 H-NS family nucleoid-associated regulatory protein -
NO458_RS13385 (NO458_13395) 2863108..2863109 - 2 WP_094187731.1 IS5 family transposase -
NO458_RS13390 (NO458_13400) 2863448..2863576 - 129 WP_012444694.1 hypothetical protein -
NO458_RS13395 (NO458_13405) 2863545..2863664 - 120 Protein_2579 IS3 family transposase -
NO458_RS13400 (NO458_13410) 2863881..2864135 - 255 WP_223293127.1 hypothetical protein -
NO458_RS13405 (NO458_13415) 2864204..2864338 - 135 WP_011051575.1 hypothetical protein -
NO458_RS13410 (NO458_13420) 2864331..2864585 - 255 WP_198912806.1 hypothetical protein -
NO458_RS13415 (NO458_13425) 2864662..2864913 - 252 WP_229001948.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NO458_RS13420 (NO458_13430) 2864940..2865218 - 279 WP_011408759.1 CopG family ribbon-helix-helix protein Antitoxin
NO458_RS13425 (NO458_13435) 2865414..2865758 - 345 WP_198912817.1 hypothetical protein -
NO458_RS13430 (NO458_13440) 2866664..2867848 - 1185 WP_011408522.1 IS256-like element IS1113 family transposase -
NO458_RS13435 (NO458_13445) 2868429..2869394 + 966 WP_109181928.1 IS1595-like element ISXo5 family transposase -
NO458_RS13440 (NO458_13450) 2869544..2870101 + 558 WP_011259349.1 DNA-3-methyladenine glycosylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 2862581..2869394 6813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-81)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9603.92 Da        Isoelectric Point: 9.9718

>T252517 WP_229001948.1 NZ_CP101703:c2864913-2864662 [Xanthomonas oryzae pv. oryzae]
MLRLREFLRPKNPDAARRAGEAIRRGVQALGAHPRMGRLIEDLSEQYREWLIDFGDSGYVARYRFDGDTVTILAVRHQKE
AGY

Download         Length: 252 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10826.11 Da        Isoelectric Point: 4.9736

>AT252517 WP_011408759.1 NZ_CP101703:c2865218-2864940 [Xanthomonas oryzae pv. oryzae]
MVTATSIKLDDELKGRVQHLAESRRRTPHWIMREAIEQYVEREEKREALNRDTLKAWDEFQATGLHVTAEEVDKWLASWG
TDDELPPPECHK

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A854CIX2

References