Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-parE/ParE-RHH
Location 2856747..2857303 Replicon chromosome
Accession NZ_CP101702
Organism Xanthomonas oryzae pv. oryzae strain CIX4509

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NO460_RS13350 Protein ID WP_229001948.1
Coordinates 2856747..2856998 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A854CIX2
Locus tag NO460_RS13355 Protein ID WP_011408759.1
Coordinates 2857025..2857303 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NO460_RS13300 (NO460_13310) 2852853..2853169 - 317 Protein_2561 ATP-dependent DNA ligase -
NO460_RS13305 (NO460_13315) 2853451..2853627 - 177 Protein_2562 DUF3606 domain-containing protein -
NO460_RS13310 (NO460_13320) 2853849..2854250 + 402 WP_011259345.1 H-NS family nucleoid-associated regulatory protein -
NO460_RS13320 (NO460_13330) 2855193..2855194 - 2 WP_094187731.1 IS5 family transposase -
NO460_RS13325 (NO460_13335) 2855533..2855661 - 129 WP_012444694.1 hypothetical protein -
NO460_RS13330 (NO460_13340) 2855630..2855749 - 120 Protein_2566 IS3 family transposase -
NO460_RS13335 (NO460_13345) 2855966..2856220 - 255 WP_223293127.1 hypothetical protein -
NO460_RS13340 (NO460_13350) 2856289..2856423 - 135 WP_011051575.1 hypothetical protein -
NO460_RS13345 (NO460_13355) 2856416..2856670 - 255 WP_198912806.1 hypothetical protein -
NO460_RS13350 (NO460_13360) 2856747..2856998 - 252 WP_229001948.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NO460_RS13355 (NO460_13365) 2857025..2857303 - 279 WP_011408759.1 CopG family ribbon-helix-helix protein Antitoxin
NO460_RS13360 (NO460_13370) 2857499..2857843 - 345 WP_198912817.1 hypothetical protein -
NO460_RS13365 (NO460_13375) 2858749..2859933 - 1185 WP_011408522.1 IS256-like element IS1113 family transposase -
NO460_RS13370 (NO460_13380) 2860514..2861479 + 966 WP_109181928.1 IS1595-like element ISXo5 family transposase -
NO460_RS13375 (NO460_13385) 2861629..2862186 + 558 WP_011259349.1 DNA-3-methyladenine glycosylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 2854666..2861479 6813


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-81)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9603.92 Da        Isoelectric Point: 9.9718

>T252513 WP_229001948.1 NZ_CP101702:c2856998-2856747 [Xanthomonas oryzae pv. oryzae]
MLRLREFLRPKNPDAARRAGEAIRRGVQALGAHPRMGRLIEDLSEQYREWLIDFGDSGYVARYRFDGDTVTILAVRHQKE
AGY

Download         Length: 252 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10826.11 Da        Isoelectric Point: 4.9736

>AT252513 WP_011408759.1 NZ_CP101702:c2857303-2857025 [Xanthomonas oryzae pv. oryzae]
MVTATSIKLDDELKGRVQHLAESRRRTPHWIMREAIEQYVEREEKREALNRDTLKAWDEFQATGLHVTAEEVDKWLASWG
TDDELPPPECHK

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A854CIX2

References