Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2317316..2317832 | Replicon | chromosome |
| Accession | NZ_CP101700 | ||
| Organism | Pseudomonas asiatica strain MD9 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | F8G1E7 |
| Locus tag | NOV18_RS11055 | Protein ID | WP_003259987.1 |
| Coordinates | 2317551..2317832 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | F8G1E6 |
| Locus tag | NOV18_RS11050 | Protein ID | WP_013972043.1 |
| Coordinates | 2317316..2317561 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NOV18_RS11030 (NOV18_11030) | 2312728..2313207 | - | 480 | WP_015269934.1 | transposase | - |
| NOV18_RS11035 (NOV18_11035) | 2313464..2314006 | - | 543 | WP_054572953.1 | WYL domain-containing protein | - |
| NOV18_RS11040 (NOV18_11040) | 2314742..2315935 | + | 1194 | WP_015269936.1 | MFS transporter | - |
| NOV18_RS11045 (NOV18_11045) | 2315966..2317072 | + | 1107 | WP_054572951.1 | alkene reductase | - |
| NOV18_RS11050 (NOV18_11050) | 2317316..2317561 | + | 246 | WP_013972043.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NOV18_RS11055 (NOV18_11055) | 2317551..2317832 | + | 282 | WP_003259987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NOV18_RS11060 (NOV18_11060) | 2317848..2318480 | - | 633 | WP_015269938.1 | BRCT domain-containing protein | - |
| NOV18_RS11065 (NOV18_11065) | 2318497..2318892 | - | 396 | WP_023662326.1 | hypothetical protein | - |
| NOV18_RS11070 (NOV18_11070) | 2318981..2319889 | - | 909 | WP_013972045.1 | LysR family transcriptional regulator | - |
| NOV18_RS11075 (NOV18_11075) | 2320181..2321485 | + | 1305 | WP_256382094.1 | MFS transporter | - |
| NOV18_RS11080 (NOV18_11080) | 2321516..2322757 | + | 1242 | WP_015269941.1 | Zn-dependent hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10909.78 Da Isoelectric Point: 10.7594
>T252508 WP_003259987.1 NZ_CP101700:2317551-2317832 [Pseudomonas asiatica]
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
MTYKLEFLPSALKEWGKLGHTVREQIKKKLAERLQSPKVQADALRDLPNHYKIKLKASGYRLVYRVEDERIVVVVVSVGK
RERSEVYRSAQKR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|