Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 1718743..1719271 Replicon chromosome
Accession NZ_CP101694
Organism Photobacterium toruni strain WD2103

Toxin (Protein)


Gene name relE Uniprot ID A0A4Q5KBD1
Locus tag NM620_RS08195 Protein ID WP_017020028.1
Coordinates 1718743..1719030 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4Q5K8I1
Locus tag NM620_RS08200 Protein ID WP_017020027.1
Coordinates 1719020..1719271 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NM620_RS08170 1714077..1714376 + 300 WP_107198478.1 hypothetical protein -
NM620_RS08175 1714373..1714717 + 345 WP_107295713.1 IS66 family insertion sequence element accessory protein TnpB -
NM620_RS08180 1714803..1716329 + 1527 WP_256382864.1 IS66 family transposase -
NM620_RS08185 1716361..1716876 + 516 Protein_1509 tyrosine-type recombinase/integrase -
NM620_RS08190 1716873..1717931 + 1059 WP_256382865.1 IS91 family transposase -
NM620_RS08195 1718743..1719030 - 288 WP_017020028.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NM620_RS08200 1719020..1719271 - 252 WP_017020027.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NM620_RS08205 1719471..1720088 - 618 WP_256382866.1 hypothetical protein -
NM620_RS08210 1720134..1720226 - 93 WP_005433818.1 DUF3265 domain-containing protein -
NM620_RS08215 1720241..1721014 - 774 WP_256382867.1 hypothetical protein -
NM620_RS08220 1721165..1721650 - 486 WP_256382868.1 hypothetical protein -
NM620_RS08225 1722369..1722857 - 489 WP_256382869.1 SLATT domain-containing protein -
NM620_RS08230 1723590..1724261 - 672 WP_256382870.1 DUF2726 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1690712..1729934 39222
- inside Integron - - 1718614..1727089 8475


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-70)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11003.03 Da        Isoelectric Point: 10.4934

>T252507 WP_017020028.1 NZ_CP101694:c1719030-1718743 [Photobacterium toruni]
MTYKLKFLPAAQKEWSKLAPPIKSQFKKKLIERLENPHVPASKLRGYDSVYKIKLRTAGYRLAYEVIDDEIVVYVLAIGK
RDKDAVYKKLASRFG

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9198.41 Da        Isoelectric Point: 4.0174

>AT252507 WP_017020027.1 NZ_CP101694:c1719271-1719020 [Photobacterium toruni]
MRQVLADCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEFLMDMLDDYELSKLVESRRLDLSDAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4Q5KBD1

Antitoxin

Source ID Structure
AlphaFold DB A0A4Q5K8I1

References