Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 4825845..4826367 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | stbE | Uniprot ID | V7IL40 |
Locus tag | NOV91_RS23470 | Protein ID | WP_000221345.1 |
Coordinates | 4825845..4826129 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NOV91_RS23475 | Protein ID | WP_000885424.1 |
Coordinates | 4826119..4826367 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS23450 (4821920) | 4821920..4823428 | - | 1509 | WP_017441357.1 | FAD-dependent oxidoreductase | - |
NOV91_RS23455 (4823473) | 4823473..4823961 | + | 489 | WP_017441356.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NOV91_RS23460 (4824154) | 4824154..4825227 | + | 1074 | WP_017441355.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NOV91_RS23465 (4825285) | 4825285..4825674 | - | 390 | WP_001652798.1 | RidA family protein | - |
NOV91_RS23470 (4825845) | 4825845..4826129 | - | 285 | WP_000221345.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NOV91_RS23475 (4826119) | 4826119..4826367 | - | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NOV91_RS23480 (4826780) | 4826780..4827133 | - | 354 | WP_000418733.1 | hypothetical protein | - |
NOV91_RS23485 (4827136) | 4827136..4827525 | - | 390 | WP_017441353.1 | hypothetical protein | - |
NOV91_RS23490 (4827890) | 4827890..4828006 | + | 117 | Protein_4579 | IS110 family transposase | - |
NOV91_RS23495 (4828529) | 4828529..4828861 | + | 333 | WP_017441352.1 | DUF1493 family protein | - |
NOV91_RS23500 (4829134) | 4829134..4830042 | + | 909 | WP_077906523.1 | hypothetical protein | - |
NOV91_RS23505 (4830044) | 4830044..4830824 | - | 781 | Protein_4582 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4824154..4835573 | 11419 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11043.79 Da Isoelectric Point: 10.6500
>T252506 WP_000221345.1 NZ_CP101689:c4826129-4825845 [Salmonella enterica subsp. enterica serovar Mbandaka]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKVTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y2FFA8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |