Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3794107..3794727 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NOV91_RS18370 | Protein ID | WP_001280991.1 |
Coordinates | 3794107..3794325 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NOV91_RS18375 | Protein ID | WP_000344807.1 |
Coordinates | 3794353..3794727 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS18330 (3789332) | 3789332..3789901 | + | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
NOV91_RS18335 (3789934) | 3789934..3790323 | - | 390 | WP_000961285.1 | MGMT family protein | - |
NOV91_RS18345 (3790554) | 3790554..3792104 | - | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
NOV91_RS18350 (3792329) | 3792329..3792589 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
NOV91_RS18355 (3792595) | 3792595..3792735 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NOV91_RS18360 (3792791) | 3792791..3793261 | - | 471 | WP_000136183.1 | YlaC family protein | - |
NOV91_RS18365 (3793377) | 3793377..3793928 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
NOV91_RS18370 (3794107) | 3794107..3794325 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NOV91_RS18375 (3794353) | 3794353..3794727 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NOV91_RS18380 (3795223) | 3795223..3798372 | - | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NOV91_RS18385 (3798395) | 3798395..3799588 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T252505 WP_001280991.1 NZ_CP101689:c3794325-3794107 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT252505 WP_000344807.1 NZ_CP101689:c3794727-3794353 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|