Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3134705..3135255 Replicon chromosome
Accession NZ_CP101689
Organism Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag NOV91_RS15300 Protein ID WP_001199743.1
Coordinates 3134947..3135255 (+) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V7ITQ8
Locus tag NOV91_RS15295 Protein ID WP_000016244.1
Coordinates 3134705..3134944 (+) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NOV91_RS15265 (3130631) 3130631..3131161 + 531 WP_017441181.1 gluconokinase -
NOV91_RS15270 (3131189) 3131189..3132208 - 1020 WP_000152563.1 NAD(P)-dependent alcohol dehydrogenase -
NOV91_RS15280 (3132966) 3132966..3133943 + 978 WP_223195356.1 IS630 family transposase -
NOV91_RS15285 (3133963) 3133963..3134271 + 309 Protein_2973 DUF4942 domain-containing protein -
NOV91_RS15290 (3134372) 3134372..3134596 + 225 WP_031233173.1 ribbon-helix-helix protein, CopG family -
NOV91_RS15295 (3134705) 3134705..3134944 + 240 WP_000016244.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NOV91_RS15300 (3134947) 3134947..3135255 + 309 WP_001199743.1 CcdB family protein Toxin
NOV91_RS15305 (3135622) 3135622..3136548 - 927 WP_017441178.1 site-specific integrase -
NOV91_RS15310 (3136538) 3136538..3138157 - 1620 WP_017441177.1 MobH family relaxase -
NOV91_RS15315 (3138448) 3138448..3138903 - 456 WP_031615695.1 NUDIX domain-containing protein -
NOV91_RS15320 (3139009) 3139009..3139920 - 912 WP_017441175.1 zincin-like metallopeptidase domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 3133011..3149445 16434
- flank IS/Tn - - 3133011..3133943 932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T252498 WP_001199743.1 NZ_CP101689:3134947-3135255 [Salmonella enterica subsp. enterica serovar Mbandaka]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8709.86 Da        Isoelectric Point: 6.4633

>AT252498 WP_000016244.1 NZ_CP101689:3134705-3134944 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5I5T4R8

References