Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3093028..3093671 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | NOV91_RS15085 | Protein ID | WP_017441191.1 |
Coordinates | 3093028..3093444 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B5F3H9 |
Locus tag | NOV91_RS15090 | Protein ID | WP_001261294.1 |
Coordinates | 3093441..3093671 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS15065 (3088065) | 3088065..3089198 | + | 1134 | WP_017441192.1 | amidohydrolase/deacetylase family metallohydrolase | - |
NOV91_RS15070 (3089182) | 3089182..3090300 | + | 1119 | WP_001139194.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NOV91_RS15075 (3090297) | 3090297..3091037 | + | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
NOV91_RS15080 (3091054) | 3091054..3092967 | + | 1914 | WP_023242878.1 | BglG family transcription antiterminator | - |
NOV91_RS15085 (3093028) | 3093028..3093444 | - | 417 | WP_017441191.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NOV91_RS15090 (3093441) | 3093441..3093671 | - | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NOV91_RS15095 (3093838) | 3093838..3094302 | - | 465 | WP_017441190.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NOV91_RS15100 (3094519) | 3094519..3096657 | - | 2139 | WP_000187821.1 | anaerobic ribonucleoside-triphosphate reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15163.55 Da Isoelectric Point: 8.1381
>T252497 WP_017441191.1 NZ_CP101689:c3093444-3093028 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAVGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|