Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2948212..2948993 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
Locus tag | NOV91_RS14345 | Protein ID | WP_000625911.1 |
Coordinates | 2948502..2948993 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | V7IUD2 |
Locus tag | NOV91_RS14340 | Protein ID | WP_001271379.1 |
Coordinates | 2948212..2948505 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS14305 (2944514) | 2944514..2945419 | + | 906 | WP_001268200.1 | YjiK family protein | - |
NOV91_RS14310 (2945713) | 2945713..2945907 | - | 195 | WP_223195369.1 | hypothetical protein | - |
NOV91_RS14315 (2945955) | 2945955..2946054 | - | 100 | Protein_2784 | hypothetical protein | - |
NOV91_RS14320 (2946074) | 2946074..2946241 | + | 168 | WP_071527476.1 | ATP-binding cassette domain-containing protein | - |
NOV91_RS14325 (2946248) | 2946248..2946535 | - | 288 | WP_072103482.1 | transcriptional regulator RtsB | - |
NOV91_RS14330 (2946532) | 2946532..2947407 | - | 876 | WP_017441228.1 | AraC family transcriptional regulator | - |
NOV91_RS14335 (2947673) | 2947673..2947894 | - | 222 | WP_001595143.1 | hypothetical protein | - |
NOV91_RS14340 (2948212) | 2948212..2948505 | + | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
NOV91_RS14345 (2948502) | 2948502..2948993 | + | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
NOV91_RS14350 (2949208) | 2949208..2949456 | + | 249 | Protein_2791 | IS481 family transposase | - |
NOV91_RS14355 (2949702) | 2949702..2949959 | - | 258 | WP_001112996.1 | hypothetical protein | - |
NOV91_RS14360 (2950553) | 2950553..2950837 | + | 285 | WP_192917775.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
NOV91_RS14365 (2950872) | 2950872..2951411 | + | 540 | WP_000721295.1 | type 1 fimbrial protein | - |
NOV91_RS14370 (2951421) | 2951421..2953859 | + | 2439 | WP_017441226.1 | F4 (K88) fimbrial usher FaeD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | faeC / faeD / faeE / faeF / faeH / faeI | 2946532..2961487 | 14955 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T252496 WP_000625911.1 NZ_CP101689:2948502-2948993 [Salmonella enterica subsp. enterica serovar Mbandaka]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10938.54 Da Isoelectric Point: 9.8590
>AT252496 WP_001271379.1 NZ_CP101689:2948212-2948505 [Salmonella enterica subsp. enterica serovar Mbandaka]
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
MSAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPQAYQEFLARLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3G3E5T9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V7IUD2 |