Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1567050..1567710 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A3V4SJP5 |
Locus tag | NOV91_RS07735 | Protein ID | WP_000244755.1 |
Coordinates | 1567050..1567463 (-) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | NOV91_RS07740 | Protein ID | WP_000351186.1 |
Coordinates | 1567444..1567710 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS07715 (1562991) | 1562991..1564724 | - | 1734 | WP_000813392.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NOV91_RS07720 (1564730) | 1564730..1565443 | - | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NOV91_RS07725 (1565467) | 1565467..1566363 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
NOV91_RS07730 (1566476) | 1566476..1566997 | + | 522 | WP_017441091.1 | flavodoxin FldB | - |
NOV91_RS07735 (1567050) | 1567050..1567463 | - | 414 | WP_000244755.1 | protein YgfX | Toxin |
NOV91_RS07740 (1567444) | 1567444..1567710 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
NOV91_RS07745 (1567960) | 1567960..1568940 | + | 981 | WP_017441090.1 | tRNA-modifying protein YgfZ | - |
NOV91_RS07750 (1569056) | 1569056..1569715 | - | 660 | WP_000250289.1 | hemolysin III family protein | - |
NOV91_RS07755 (1569879) | 1569879..1570190 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
NOV91_RS07760 (1570348) | 1570348..1571781 | + | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16164.10 Da Isoelectric Point: 10.2118
>T252490 WP_000244755.1 NZ_CP101689:c1567463-1567050 [Salmonella enterica subsp. enterica serovar Mbandaka]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLHPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT252490 WP_000351186.1 NZ_CP101689:c1567710-1567444 [Salmonella enterica subsp. enterica serovar Mbandaka]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V4SJP5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |