Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1408690..1409504 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3W0Q3Z8 |
Locus tag | NOV91_RS07015 | Protein ID | WP_017441137.1 |
Coordinates | 1408977..1409504 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A418Z520 |
Locus tag | NOV91_RS07010 | Protein ID | WP_017441138.1 |
Coordinates | 1408690..1408980 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS06980 (1404618) | 1404618..1405268 | - | 651 | WP_001728903.1 | type III secretion system transcriptional activator InvF | - |
NOV91_RS06985 (1405724) | 1405724..1406167 | + | 444 | WP_017441140.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NOV91_RS06990 (1406599) | 1406599..1407048 | + | 450 | WP_017441139.1 | hypothetical protein | - |
NOV91_RS06995 (1407033) | 1407033..1407380 | + | 348 | WP_001555786.1 | DUF1493 family protein | - |
NOV91_RS07000 (1407653) | 1407653..1407979 | - | 327 | WP_000393295.1 | hypothetical protein | - |
NOV91_RS07005 (1408220) | 1408220..1408420 | + | 201 | Protein_1370 | IS3 family transposase | - |
NOV91_RS07010 (1408690) | 1408690..1408980 | + | 291 | WP_017441138.1 | DUF1778 domain-containing protein | Antitoxin |
NOV91_RS07015 (1408977) | 1408977..1409504 | + | 528 | WP_017441137.1 | GNAT family N-acetyltransferase | Toxin |
NOV91_RS07020 (1409577) | 1409577..1409792 | - | 216 | Protein_1373 | IS5/IS1182 family transposase | - |
NOV91_RS07025 (1410130) | 1410130..1410786 | + | 657 | WP_017441135.1 | protein-serine/threonine phosphatase | - |
NOV91_RS07030 (1410957) | 1410957..1411451 | - | 495 | WP_000424947.1 | hypothetical protein | - |
NOV91_RS07035 (1411478) | 1411478..1412146 | - | 669 | WP_000445914.1 | hypothetical protein | - |
NOV91_RS07040 (1412303) | 1412303..1412542 | - | 240 | Protein_1377 | hypothetical protein | - |
NOV91_RS07045 (1412733) | 1412733..1413131 | - | 399 | Protein_1378 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1409577..1409717 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19035.89 Da Isoelectric Point: 9.6420
>T252489 WP_017441137.1 NZ_CP101689:1408977-1409504 [Salmonella enterica subsp. enterica serovar Mbandaka]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SLKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10721.55 Da Isoelectric Point: 8.5957
>AT252489 WP_017441138.1 NZ_CP101689:1408690-1408980 [Salmonella enterica subsp. enterica serovar Mbandaka]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFARPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3W0Q3Z8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A418Z520 |