Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 94594..95237 | Replicon | plasmid pM171-1.1 |
| Accession | NZ_CP101667 | ||
| Organism | Escherichia coli strain M171-1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | NO473_RS22760 | Protein ID | WP_001044768.1 |
| Coordinates | 94594..95010 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | NO473_RS22765 | Protein ID | WP_001261287.1 |
| Coordinates | 95007..95237 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NO473_RS22745 (89898) | 89898..90791 | - | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
| NO473_RS22750 (90834) | 90834..91829 | - | 996 | WP_000246636.1 | hypothetical protein | - |
| NO473_RS22755 (92294) | 92294..94432 | + | 2139 | WP_039002805.1 | AAA family ATPase | - |
| NO473_RS22760 (94594) | 94594..95010 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NO473_RS22765 (95007) | 95007..95237 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NO473_RS22770 (95543) | 95543..96091 | + | 549 | WP_039002808.1 | hypothetical protein | - |
| NO473_RS22775 (96143) | 96143..96973 | + | 831 | WP_223201786.1 | hypothetical protein | - |
| NO473_RS22780 (97024) | 97024..98661 | + | 1638 | WP_223201785.1 | hypothetical protein | - |
| NO473_RS22785 (98924) | 98924..100057 | + | 1134 | Protein_113 | DUF3800 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / sul3 / aph(3')-Ia / sul2 / floR / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / tet(M) | - | 1..122198 | 122198 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T252482 WP_001044768.1 NZ_CP101667:c95010-94594 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |